| UniProt ID | CRHBP_HUMAN | |
|---|---|---|
| UniProt AC | P24387 | |
| Protein Name | Corticotropin-releasing factor-binding protein | |
| Gene Name | CRHBP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 322 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Binds CRF and inactivates it. May prevent inappropriate pituitary-adrenal stimulation in pregnancy.. | |
| Protein Sequence | MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | HFILIFLTALRGESR HHHHHHHHHHCCCCH | 16.94 | 24719451 | |
| 23 | Phosphorylation | LTALRGESRYLELRE HHHHCCCCHHHHHHH | 29.11 | 25404012 | |
| 25 | Phosphorylation | ALRGESRYLELREAA HHCCCCHHHHHHHHC | 17.51 | 25404012 | |
| 204 | N-linked_Glycosylation | VVPHQHRNCSFSIIY EECCCCCCCCEEEEE | 24.53 | UniProtKB CARBOHYD | |
| 206 | Phosphorylation | PHQHRNCSFSIIYPV CCCCCCCCEEEEEEE | 26.10 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRHBP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRHBP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRHBP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UCN1_HUMAN | UCN | physical | 8612563 | |
| TBB1_HUMAN | TUBB1 | physical | 26186194 | |
| TNIP1_HUMAN | TNIP1 | physical | 26186194 | |
| CCNB2_HUMAN | CCNB2 | physical | 26186194 | |
| PLSI_HUMAN | PLS1 | physical | 26186194 | |
| PHLB3_HUMAN | PHLDB3 | physical | 26186194 | |
| IF1AX_HUMAN | EIF1AX | physical | 26186194 | |
| SQSTM_HUMAN | SQSTM1 | physical | 26186194 | |
| COA7_HUMAN | COA7 | physical | 26186194 | |
| TNIP1_HUMAN | TNIP1 | physical | 28514442 | |
| CCNB2_HUMAN | CCNB2 | physical | 28514442 | |
| PHLB3_HUMAN | PHLDB3 | physical | 28514442 | |
| TBB1_HUMAN | TUBB1 | physical | 28514442 | |
| COA7_HUMAN | COA7 | physical | 28514442 | |
| SQSTM_HUMAN | SQSTM1 | physical | 28514442 | |
| UBR1_HUMAN | UBR1 | physical | 28514442 | |
| PLSI_HUMAN | PLS1 | physical | 28514442 | |
| UBR2_HUMAN | UBR2 | physical | 28514442 | |
| IF1AX_HUMAN | EIF1AX | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
