UCN1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UCN1_HUMAN
• UniProt AC: P55089
• Protein Name: Urocortin
• Gene Name: UCN
• Organism: Homo sapiens (Human).
• Sequence Length: 124
• Subcellular Localization: Secreted.
• Protein Description: Acts in vitro to stimulate the secretion of adrenocorticotropic hormone (ACTH). [PubMed: 8612563 Binds with high affinity to CRF receptor types 1, 2-alpha, and 2-beta]
• Protein Sequence: MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
122	Valine amide	NRIIFDSVGK----- HCCCCCCCCC-----	14.09	-
122	Amidation	NRIIFDSVGK----- HCCCCCCCCC-----	14.09	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UCN1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UCN1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UCN1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CRFR1_RAT	Crhr1	physical	9423932
CRFR2_RAT	Crhr2	physical	9423932
CRFR1_HUMAN	CRHR1	physical	9423932

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.