CRFR2_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CRFR2_RAT
• UniProt AC: P47866
• Protein Name: Corticotropin-releasing factor receptor 2
• Gene Name: Crhr2
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 411
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein .
• Protein Description: G-protein coupled receptor for CRH (corticotropin-releasing factor), UCN (urocortin), UCN2 and UCN3. Has high affinity for UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels..
• Protein Sequence: MDAALLLSLLEANCSLALAEELLLDGWGEPPDPEGPYSYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIINYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNITWFLLQLIDHEVHEGNEVWCRCVTTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIVAWAVGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRSALRKRWHRWQDHHALRVPVARAMSIPTSPTRISFHSIKQTAAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	N-linked_Glycosylation	LLSLLEANCSLALAE HHHHHHHHHHHHHHH	13.41	16766521
41	N-linked_Glycosylation	EGPYSYCNTTLDQIG CCCCCCCCCCHHHCC	28.06	-
74	N-linked_Glycosylation	YFNGIKYNTTRNAYR HHCCCCCCCCHHHHH	29.94	-
86	N-linked_Glycosylation	AYRECLENGTWASRV HHHHHHHHCCEECCC	40.00	-
94	N-linked_Glycosylation	GTWASRVNYSHCEPI CCEECCCCHHHCEEC	31.01	-
392	Phosphorylation	VPVARAMSIPTSPTR CCHHHHCCCCCCCCE	25.16	28432305
395	Phosphorylation	ARAMSIPTSPTRISF HHHCCCCCCCCEEEE	45.74	28432305
396	Phosphorylation	RAMSIPTSPTRISFH HHCCCCCCCCEEEEE	20.94	28432305
398	Phosphorylation	MSIPTSPTRISFHSI CCCCCCCCEEEEECC	40.16	28432305

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CRFR2_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CRFR2_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CRFR2_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UCN1_HUMAN	UCN	physical	8612563
UCN1_RAT	Ucn	physical	11416224
UCN2_HUMAN	UCN2	physical	11416224
UCN3_HUMAN	UCN3	physical	11416224
UCN2_MOUSE	Ucn2	physical	11416224
UCN3_MOUSE	Ucn3	physical	11416224

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.