UniProt ID | UCN3_HUMAN | |
---|---|---|
UniProt AC | Q969E3 | |
Protein Name | Urocortin-3 | |
Gene Name | UCN3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 161 | |
Subcellular Localization | Secreted. | |
Protein Description | Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.. | |
Protein Sequence | MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSGEEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | Phosphorylation | YKAKPIFSCLNTALS CCCHHHHHHHHHHHH | 20.58 | 26270265 | |
38 | Phosphorylation | PIFSCLNTALSEAEK HHHHHHHHHHHHHHC | 18.94 | 26270265 | |
41 | Phosphorylation | SCLNTALSEAEKGQW HHHHHHHHHHHCCCC | 32.09 | 26270265 | |
52 | Phosphorylation | KGQWEDASLLSKRSF CCCCCCHHHHHHHHH | 42.01 | 24719451 | |
58 | Phosphorylation | ASLLSKRSFHYLRSR HHHHHHHHHHHHHHC | 21.80 | 24719451 | |
64 | Phosphorylation | RSFHYLRSRDASSGE HHHHHHHHCCCCCCC | 31.73 | 24719451 | |
68 | Phosphorylation | YLRSRDASSGEEEEG HHHHCCCCCCCCCCC | 43.07 | 27282143 | |
69 | Phosphorylation | LRSRDASSGEEEEGK HHHCCCCCCCCCCCC | 52.52 | 26657352 | |
80 | Phosphorylation | EEGKEKKTFPISGAR CCCCCCCCCCCCCCC | 45.79 | 23403867 | |
95 | Phosphorylation | GGARGTRYRYVSQAQ CCCCCCCEEEEECCC | 13.21 | - | |
99 | Phosphorylation | GTRYRYVSQAQPRGK CCCEEEEECCCCCCC | 15.74 | 24850871 | |
157 | Isoleucine amide | NAHLMAQIGRKK--- HHHHHHHHCCCC--- | 4.12 | - | |
157 | Amidation | NAHLMAQIGRKK--- HHHHHHHHCCCC--- | 4.12 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UCN3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UCN3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UCN3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UCN3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...