UCN2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UCN2_MOUSE
• UniProt AC: Q99ML8
• Protein Name: Urocortin-2
• Gene Name: Ucn2
• Organism: Mus musculus (Mouse).
• Sequence Length: 113
• Subcellular Localization: Secreted .
• Protein Description: Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress (By similarity)..
• Protein Sequence: MMTRWALVVFVVLMLDRILFVPGTPIPTFQLLPQNSLETTPSSVTSESSSGTTTGPSASWSNSKASPYLDTRVILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHVGRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
110	Valine amide	NAQILAHVGRR---- HHHHHHHHCCC----	15.13	-
110	Amidation	NAQILAHVGRR---- HHHHHHHHCCC----	15.13	23493376

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UCN2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UCN2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UCN2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of UCN2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.