| UniProt ID | CPLX2_HUMAN | |
|---|---|---|
| UniProt AC | Q6PUV4 | |
| Protein Name | Complexin-2 | |
| Gene Name | CPLX2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 134 | |
| Subcellular Localization | Cytoplasm, cytosol. Enriched at synaptic-releasing sites in mature neurons.. | |
| Protein Description | Negatively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. Positively regulates a late step in exocytosis of various cytoplasmic vesicles, such as synaptic vesicles and other secretory vesicles. Also involved in mast cell exocytosis (By similarity).. | |
| Protein Sequence | MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Ubiquitination | --MDFVMKQALGGAT --CCHHHHHHCCCCC | 27.41 | 33845483 | |
| 13 | Phosphorylation | KQALGGATKDMGKML HHHCCCCCHHHHHHC | 30.74 | 28348404 | |
| 14 | Acetylation | QALGGATKDMGKMLG HHCCCCCHHHHHHCC | 45.22 | 19608861 | |
| 18 | Ubiquitination | GATKDMGKMLGGEEE CCCHHHHHHCCCCCC | 25.06 | 33845483 | |
| 26 | Ubiquitination | MLGGEEEKDPDAQKK HCCCCCCCCCHHHHH | 77.25 | 33845483 | |
| 32 | Ubiquitination | EKDPDAQKKEEERQE CCCCHHHHHHHHHHH | 64.97 | 33845483 | |
| 70 | Phosphorylation | RQQIRDKYGLKKKEE HHHHHHHHCCCHHHH | 31.79 | 22817900 | |
| 83 | Ubiquitination | EEKEAEEKAALEQPC HHHHHHHHHHHCCCC | 30.39 | 33845483 | |
| 93 | Phosphorylation | LEQPCEGSLTRPKKA HCCCCCCCCCCCCCC | 12.32 | 27422710 | |
| 95 | Phosphorylation | QPCEGSLTRPKKAIP CCCCCCCCCCCCCCC | 46.77 | 29116813 | |
| 98 | Ubiquitination | EGSLTRPKKAIPAGC CCCCCCCCCCCCCCC | 52.09 | 33845483 | |
| 99 | Ubiquitination | GSLTRPKKAIPAGCG CCCCCCCCCCCCCCC | 54.98 | 33845483 | |
| 133 | Ubiquitination | GPLQDMFKK------ CCHHHHHCC------ | 51.43 | 33845483 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CPLX2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CPLX2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CPLX2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| AN13C_HUMAN | ANKRD13C | physical | 28514442 | |
| WAC2A_HUMAN | FAM21A | physical | 28514442 | |
| RAP1A_HUMAN | RAP1A | physical | 28514442 | |
| DEGS1_HUMAN | DEGS1 | physical | 28514442 | |
| SCPDL_HUMAN | SCCPDH | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-14, AND MASS SPECTROMETRY. | |
