UniProt ID | CHCH1_HUMAN | |
---|---|---|
UniProt AC | Q96BP2 | |
Protein Name | Coiled-coil-helix-coiled-coil-helix domain-containing protein 1 | |
Gene Name | CHCHD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 118 | |
Subcellular Localization | Mitochondrion . Nucleus . | |
Protein Description | ||
Protein Sequence | MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MATPSLRGRL -----CCCHHHHHHH | 16.47 | 24719451 | |
5 | Phosphorylation | ---MATPSLRGRLAR ---CCCHHHHHHHHH | 26.75 | 24719451 | |
7 | Methylation | -MATPSLRGRLARFG -CCCHHHHHHHHHCC | 32.30 | - | |
68 | Ubiquitination | FRDDACRKEIQGFLD CCCHHHHHHHHHHHH | 60.08 | 29967540 | |
103 | Ubiquitination | SGSLLPNKLNKLLQR CCCCCCHHHHHHHHH | 52.04 | 22817900 | |
106 | Ubiquitination | LLPNKLNKLLQRFPN CCCHHHHHHHHHCCC | 62.10 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CHCH1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CHCH1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CHCH1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CHCH1_HUMAN | CHCHD1 | physical | 27499296 | |
PPM1K_HUMAN | PPM1K | physical | 27499296 | |
NRDC_HUMAN | NRD1 | physical | 27499296 | |
IDE_HUMAN | IDE | physical | 27499296 | |
MIA40_HUMAN | CHCHD4 | physical | 27499296 | |
MPPA_HUMAN | PMPCA | physical | 27499296 | |
CBY1_HUMAN | CBY1 | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...