UniProt ID | CD5_HUMAN | |
---|---|---|
UniProt AC | P06127 | |
Protein Name | T-cell surface glycoprotein CD5 | |
Gene Name | CD5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 495 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein. |
|
Protein Description | May act as a receptor in regulating T-cell proliferation.. | |
Protein Sequence | MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Phosphorylation | PDFQARLTRSNSKCQ HHHHHHHCCCCCCCC | 26.88 | 29083192 | |
40 | Phosphorylation | FQARLTRSNSKCQGQ HHHHHCCCCCCCCEE | 39.97 | 29083192 | |
42 | Phosphorylation | ARLTRSNSKCQGQLE HHHCCCCCCCCEEEE | 35.73 | 29083192 | |
51 | Phosphorylation | CQGQLEVYLKDGWHM CCEEEEEEEECCEEE | 9.92 | 29083192 | |
79 | Ubiquitination | EDPSQASKVCQRLNC CCHHHHHHHHHHCCC | 50.47 | - | |
116 | N-linked_Glycosylation | GQLGSFSNCSHSRND EECCCCCCCCCCCCC | 29.33 | UniProtKB CARBOHYD | |
142 | Phosphorylation | PQKTTPPTTRPPPTT CCCCCCCCCCCCCCC | 36.32 | 22210691 | |
150 | Phosphorylation | TRPPPTTTPEPTAPP CCCCCCCCCCCCCCC | 28.29 | 22210691 | |
184 | O-linked_Glycosylation | YSGSLGGTISYEAQD ECCCCCCEEEEECCC | 12.64 | OGP | |
186 | Phosphorylation | GSLGGTISYEAQDKT CCCCCEEEEECCCCC | 19.43 | - | |
208 | Phosphorylation | CNNLQCGSFLKHLPE HCCCCCCHHHHHCCC | 34.72 | 24719451 | |
211 | Ubiquitination | LQCGSFLKHLPETEA CCCCHHHHHCCCCCC | 40.88 | 29967540 | |
241 | N-linked_Glycosylation | PIQWKIQNSSCTSLE CCEEEEECCCCCCHH | 39.09 | UniProtKB CARBOHYD | |
273 | Ubiquitination | LCSGFQPKVQSRLVG HHCCCCHHHCEEECC | 41.97 | - | |
308 | Phosphorylation | CDSSSARSSLRWEEV CCCCCCHHHCCHHHH | 33.18 | 29083192 | |
309 | Phosphorylation | DSSSARSSLRWEEVC CCCCCHHHCCHHHHH | 19.19 | 29083192 | |
327 | Phosphorylation | QCGSVNSYRVLDAGD CCCCCCEEEEECCCC | 10.27 | 22210691 | |
346 | Ubiquitination | GLFCPHQKLSQCHEL CCCCCCHHHHHHHHH | 47.25 | - | |
361 | Ubiquitination | WERNSYCKKVFVTCQ HHHCCCCCEEEEEEC | 43.68 | 29967540 | |
421 | Phosphorylation | QRQWIGPTGMNQNMS CCCCCCCCCCCCCCC | 43.80 | 23684312 | |
428 | Phosphorylation | TGMNQNMSFHRNHTA CCCCCCCCEECCCCH | 26.00 | 23401153 | |
434 | Phosphorylation | MSFHRNHTATVRSHA CCEECCCCHHHHHHC | 27.80 | 30576142 | |
436 | Phosphorylation | FHRNHTATVRSHAEN EECCCCHHHHHHCCC | 20.01 | 30576142 | |
439 | Phosphorylation | NHTATVRSHAENPTA CCCHHHHHHCCCCCC | 23.78 | 19605366 | |
445 | Phosphorylation | RSHAENPTASHVDNE HHHCCCCCCCCCCCC | 52.99 | 28796482 | |
447 | Phosphorylation | HAENPTASHVDNEYS HCCCCCCCCCCCCCC | 26.90 | 28796482 | |
453 | Phosphorylation | ASHVDNEYSQPPRNS CCCCCCCCCCCCCCC | 20.89 | 19605366 | |
454 | Phosphorylation | SHVDNEYSQPPRNSH CCCCCCCCCCCCCCC | 29.99 | 28796482 | |
460 | Phosphorylation | YSQPPRNSHLSAYPA CCCCCCCCCCCHHHH | 27.38 | 23401153 | |
463 | Phosphorylation | PPRNSHLSAYPALEG CCCCCCCCHHHHHHH | 21.97 | 28122231 | |
465 | Phosphorylation | RNSHLSAYPALEGAL CCCCCCHHHHHHHHH | 5.90 | 11751967 | |
475 | Phosphorylation | LEGALHRSSMQPDNS HHHHHHHHCCCCCCC | 21.29 | 28796482 | |
476 | Phosphorylation | EGALHRSSMQPDNSS HHHHHHHCCCCCCCC | 22.76 | 28796482 | |
482 | Phosphorylation | SSMQPDNSSDSDYDL HCCCCCCCCCCCCCC | 42.79 | 23401153 | |
483 | Phosphorylation | SMQPDNSSDSDYDLH CCCCCCCCCCCCCCC | 47.60 | 23401153 | |
485 | Phosphorylation | QPDNSSDSDYDLHGA CCCCCCCCCCCCCCH | 39.76 | 28787133 | |
487 | Phosphorylation | DNSSDSDYDLHGAQR CCCCCCCCCCCCHHC | 25.10 | 28787133 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
434 | T | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
434 | T | Phosphorylation | Kinase | PKCA | P05696 | PSP |
434 | T | Phosphorylation | Kinase | PRKCB | P68403 | GPS |
434 | T | Phosphorylation | Kinase | PRKCG | P05129 | GPS |
436 | T | Phosphorylation | Kinase | PRKCG | P05129 | GPS |
436 | T | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
436 | T | Phosphorylation | Kinase | PKCA | P05696 | PSP |
436 | T | Phosphorylation | Kinase | PRKCB | P68403 | GPS |
453 | Y | Phosphorylation | Kinase | LCK | P06239 | PSP |
453 | Y | Phosphorylation | Kinase | FYN | P06241 | PSP |
482 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
482 | S | Phosphorylation | Kinase | CK2_GROUP | - | PhosphoELM |
482 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
483 | S | Phosphorylation | Kinase | CK2_GROUP | - | PhosphoELM |
483 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
483 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
485 | S | Phosphorylation | Kinase | CK2_GROUP | - | PhosphoELM |
485 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
485 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
487 | Y | Phosphorylation | Kinase | LCK | P06239 | PSP |
487 | Y | Phosphorylation | Kinase | FYN | P06241 | PSP |
- | K | Ubiquitination | E3 ubiquitin ligase | CBL | P22681 | PMID:22199232 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CD6_HUMAN | CD6 | physical | 12473675 | |
PTN6_HUMAN | PTPN6 | physical | 10082557 | |
CBL_HUMAN | CBL | physical | 9603468 | |
RASA1_HUMAN | RASA1 | physical | 9603468 | |
LCK_HUMAN | LCK | physical | 21757751 | |
FYN_HUMAN | FYN | physical | 21757751 | |
CD72_HUMAN | CD72 | physical | 1711157 |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-439; TYR-453; SER-482;SER-483 AND SER-485, AND MASS SPECTROMETRY. | |
"Profiling of tyrosine phosphorylation pathways in human cells usingmass spectrometry."; Salomon A.R., Ficarro S.B., Brill L.M., Brinker A., Phung Q.T.,Ericson C., Sauer K., Brock A., Horn D.M., Schultz P.G., Peters E.C.; Proc. Natl. Acad. Sci. U.S.A. 100:443-448(2003). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-439; TYR-453 ANDSER-460, AND MASS SPECTROMETRY. |