UniProt ID | CD72_HUMAN | |
---|---|---|
UniProt AC | P21854 | |
Protein Name | B-cell differentiation antigen CD72 | |
Gene Name | CD72 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 359 | |
Subcellular Localization |
Membrane Single-pass type II membrane protein. |
|
Protein Description | Plays a role in B-cell proliferation and differentiation.. | |
Protein Sequence | MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MAEAITYADLRFVK -CCCCCCHHHHHHHC | 7.63 | 28064214 | |
39 | Phosphorylation | DDDGEITYENVQVPA CCCCCEEEECCCCCE | 15.92 | 21394647 | |
110 | Phosphorylation | TCLLLGVTAICLGVR HHHHHHHHHHHHHHH | 14.43 | - | |
136 | N-linked_Glycosylation | NRVLEVTNSSLRQQL CCHHHHCCHHHHHHH | 34.47 | UniProtKB CARBOHYD | |
153 | Phosphorylation | KITQLGQSAEDLQGS HHHHHHCCHHHHHHH | 31.65 | 28857561 | |
167 | Phosphorylation | SRRELAQSQEALQVE HHHHHHHHHHHHHHH | 25.12 | 28857561 | |
196 | Methylation | QADRQKTKETLQSEE HHHHHHHHHHHHHHH | 56.59 | 23644510 | |
331 | Phosphorylation | KCNKVHKTWSWWTLE CCCCCEECCEEEEEC | 15.17 | - | |
353 | Phosphorylation | LPYICEMTAFRFPD- CCEEEEEECEECCC- | 10.60 | 18452278 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD72_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD72_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PTN6_HUMAN | PTPN6 | physical | 9590210 | |
SEM4D_HUMAN | SEMA4D | physical | 11114375 | |
PTN6_HUMAN | PTPN6 | physical | 11114375 | |
BLNK_HUMAN | BLNK | physical | 10820378 | |
SIG10_HUMAN | SIGLEC10 | physical | 28514442 | |
KLH15_HUMAN | KLHL15 | physical | 28514442 | |
CALL3_HUMAN | CALML3 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...