UniProt ID | CB068_HUMAN | |
---|---|---|
UniProt AC | Q2NKX9 | |
Protein Name | UPF0561 protein C2orf68 | |
Gene Name | C2orf68 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 166 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEAGPHPRPGHCCKPGGRLDMNHGFVHHIRRNQIARDDYDKKVKQAAKEKVRRRHTPAPTRPRKPDLQVYLPRHRDVSAHPRNPDYEESGESSSSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAHTPLDPPMREALKLRIQEEIAKRQSQH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Acetylation | PRPGHCCKPGGRLDM CCCCCCCCCCCCEEC | 52.68 | 11792093 | |
36 | Methylation | IRRNQIARDDYDKKV HHHHHHCCCHHHHHH | 38.67 | - | |
56 | Phosphorylation | EKVRRRHTPAPTRPR HHHHHHCCCCCCCCC | 21.23 | 29449344 | |
70 | Phosphorylation | RKPDLQVYLPRHRDV CCCCCEEECCCCCCC | 9.68 | 27642862 | |
78 | Phosphorylation | LPRHRDVSAHPRNPD CCCCCCCCCCCCCCC | 25.75 | 23312004 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CB068_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CB068_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CB068_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KLH15_HUMAN | KLHL15 | physical | 26186194 | |
GEMI_HUMAN | GMNN | physical | 26186194 | |
EST1A_HUMAN | SMG6 | physical | 26186194 | |
GLCNE_HUMAN | GNE | physical | 26186194 | |
DDHD2_HUMAN | DDHD2 | physical | 26186194 | |
PIR_HUMAN | PIR | physical | 26186194 | |
NAGK_HUMAN | NAGK | physical | 26186194 | |
EST1A_HUMAN | SMG6 | physical | 28514442 | |
GLCNE_HUMAN | GNE | physical | 28514442 | |
PIR_HUMAN | PIR | physical | 28514442 | |
DDHD2_HUMAN | DDHD2 | physical | 28514442 | |
GEMI_HUMAN | GMNN | physical | 28514442 | |
KLH15_HUMAN | KLHL15 | physical | 28514442 | |
GRP75_HUMAN | HSPA9 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...