| UniProt ID | CB068_HUMAN | |
|---|---|---|
| UniProt AC | Q2NKX9 | |
| Protein Name | UPF0561 protein C2orf68 | |
| Gene Name | C2orf68 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 166 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MEAGPHPRPGHCCKPGGRLDMNHGFVHHIRRNQIARDDYDKKVKQAAKEKVRRRHTPAPTRPRKPDLQVYLPRHRDVSAHPRNPDYEESGESSSSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAHTPLDPPMREALKLRIQEEIAKRQSQH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Acetylation | PRPGHCCKPGGRLDM CCCCCCCCCCCCEEC | 52.68 | 11792093 | |
| 36 | Methylation | IRRNQIARDDYDKKV HHHHHHCCCHHHHHH | 38.67 | - | |
| 56 | Phosphorylation | EKVRRRHTPAPTRPR HHHHHHCCCCCCCCC | 21.23 | 29449344 | |
| 70 | Phosphorylation | RKPDLQVYLPRHRDV CCCCCEEECCCCCCC | 9.68 | 27642862 | |
| 78 | Phosphorylation | LPRHRDVSAHPRNPD CCCCCCCCCCCCCCC | 25.75 | 23312004 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CB068_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CB068_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CB068_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KLH15_HUMAN | KLHL15 | physical | 26186194 | |
| GEMI_HUMAN | GMNN | physical | 26186194 | |
| EST1A_HUMAN | SMG6 | physical | 26186194 | |
| GLCNE_HUMAN | GNE | physical | 26186194 | |
| DDHD2_HUMAN | DDHD2 | physical | 26186194 | |
| PIR_HUMAN | PIR | physical | 26186194 | |
| NAGK_HUMAN | NAGK | physical | 26186194 | |
| EST1A_HUMAN | SMG6 | physical | 28514442 | |
| GLCNE_HUMAN | GNE | physical | 28514442 | |
| PIR_HUMAN | PIR | physical | 28514442 | |
| DDHD2_HUMAN | DDHD2 | physical | 28514442 | |
| GEMI_HUMAN | GMNN | physical | 28514442 | |
| KLH15_HUMAN | KLHL15 | physical | 28514442 | |
| GRP75_HUMAN | HSPA9 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...