BL1S6_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BL1S6_DROME
• UniProt AC: Q9VTM0
• Protein Name: Biogenesis of lysosome-related organelles complex 1 subunit 6
• Gene Name: Pallidin {ECO:0000312|FlyBase:FBgn0036192}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 167
• Protein Description: Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1) involved in pigment granule biogenesis..
• Protein Sequence: MLKSSNINSVLNELPNDPARDSTAQSSHNGKPKQDAETCCSSQDNEVMASLAALQLSAGVLQIAEPPLNHVRTQLRELIGRQNKTYIDLSKEKYKLDCSEVARLNDMMSDVKRYKDKLTKIKKEMQGVYQRTKELKKRAANVAACKQRDYQRKLERLQHEESLIGSQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
26	Phosphorylation	ARDSTAQSSHNGKPK CCCCCCCCCCCCCCC		21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BL1S6_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BL1S6_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BL1S6_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BL1S1_DROME	Blos1	physical	14605208
TFP11_DROME	sip1	physical	14605208
LSG1_DROME	Ns3	physical	14605208
DTBP1_DROME	Dysb	physical	14605208
EF1A1_DROME	Ef1alpha48D	physical	14605208
ANM7_DROME	Art7	physical	14605208
BL1S1_DROME	Blos1	physical	20015953
BL1S4_DROME	Blos4	physical	20015953
DTBP1_DROME	Dysb	physical	25568125
DTBP1_DROME	Dysb	physical	20015953

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.