BL1S1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BL1S1_DROME
• UniProt AC: A1Z9S1
• Protein Name: Biogenesis of lysosome-related organelles complex 1 subunit 1
• Gene Name: Blos1 {ECO:0000312|FlyBase:FBgn0050077}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 147
• Protein Description: Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1) involved in pigment granule biogenesis..
• Protein Sequence: MLTSMVKEHHKEQAKRKQEQEVRRKEAIEASNELTQSLVDTLNVGVAQAYLNQKRLDAEAKQLHLGATNFAKQTHQWLQLIDQFSTALKDLGDVENWARSIEGDMHTINQTLELAYKASRATQTSSGAGTSLEASTSASASANPSAT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of BL1S1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BL1S1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BL1S1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BL1S1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KARG_DROME	Argk	physical	14605208
CNN_DROME	cnn	physical	14605208
DYL2_DROME	Cdlc2	physical	14605208
NUP54_DROME	Nup54	physical	14605208
WHITE_DROME	w	genetic	20015953
DTBP1_DROME	Dysb	genetic	25568125
AP3D_DROME	g	genetic	20015953

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.