UniProt ID | ATF4_MOUSE | |
---|---|---|
UniProt AC | Q06507 | |
Protein Name | Cyclic AMP-dependent transcription factor ATF-4 | |
Gene Name | Atf4 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 349 | |
Subcellular Localization | Cytoplasm . Cell membrane . Nucleus . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Colocalizes with GABBR1 in hippocampal neuron dendritic membranes. Colocalizes with NEK6 in the centrosome (By similarity). | |
Protein Description | Transcriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Binds to asymmetric CRE's as a heterodimer and to palindromic CRE's as a homodimer. Cooperates with FOXO1 in osteoblasts to regulate glucose homeostasis through suppression of beta-cell production and decrease in insulin production. Regulates the induction of DDIT3/CHOP and asparagine synthetase (ASNS) in response to ER stress. In concert with DDIT3/CHOP, activates the transcription of TRIB3 and promotes ER stress-induced neuronal apoptosis by regulating the transcriptional induction of BBC3/PUMA. Activates transcription of SIRT4. Regulates the circadian expression of the core clock component PER2 and the serotonin transporter SLC6A4. Binds in a circadian time-dependent manner to the cAMP response elements (CRE) in the SLC6A4 and PER2 promoters and periodically activates the transcription of these genes.. | |
Protein Sequence | MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWPAMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
60 | Hydroxylation | KAGSSEWPAMDDGLA CCCCCCCCCCCCCCC | 17.41 | 24809345 | |
91 | Ubiquitination | MLEKMDLKEFDFDAL HHHCCCCCCCCHHHE | 52.66 | - | |
212 | Phosphorylation | PCVKEEDTPSDNDSG CCCCCCCCCCCCCCC | 28.15 | 23663782 | |
214 | Phosphorylation | VKEEDTPSDNDSGIC CCCCCCCCCCCCCCC | 51.65 | - | |
218 | Phosphorylation | DTPSDNDSGICMSPE CCCCCCCCCCCCCHH | 35.99 | 23663782 | |
223 | Phosphorylation | NDSGICMSPESYLGS CCCCCCCCHHHHCCC | 22.54 | 23663782 | |
230 | Phosphorylation | SPESYLGSPQHSPST CHHHHCCCCCCCCCC | 20.84 | 23663782 | |
234 | Phosphorylation | YLGSPQHSPSTSRAP HCCCCCCCCCCCCCC | 18.46 | 23663782 | |
235 | Hydroxylation | LGSPQHSPSTSRAPP CCCCCCCCCCCCCCC | 39.23 | 24809345 | |
247 | Phosphorylation | APPDNLPSPGGSRGS CCCCCCCCCCCCCCC | 39.07 | 25619855 | |
251 | Phosphorylation | NLPSPGGSRGSPRPK CCCCCCCCCCCCCCC | 39.11 | 25619855 | |
254 | Phosphorylation | SPGGSRGSPRPKPYD CCCCCCCCCCCCCCC | 19.34 | 27841257 | |
309 | Acetylation | EALTGECKELEKKNE HHHHHHHHHHHHHHH | 62.12 | - | |
341 | Acetylation | DLIEEVRKARGKKRV HHHHHHHHHHCCCCC | 47.84 | 88873 | |
346 | Acetylation | VRKARGKKRVP---- HHHHHCCCCCC---- | 62.54 | 88877 |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
212 | T | Phosphorylation |
| 23663782 |
212 | T | ubiquitylation |
| 23663782 |
214 | S | Phosphorylation |
| 23663782 |
218 | S | Phosphorylation |
| 23663782 |
218 | S | ubiquitylation |
| 23663782 |
223 | S | Phosphorylation |
| 23663782 |
223 | S | ubiquitylation |
| 23663782 |
230 | S | Phosphorylation |
| 23663782 |
230 | S | ubiquitylation |
| 23663782 |
234 | S | Phosphorylation |
| 23663782 |
234 | S | ubiquitylation |
| 23663782 |
247 | S | Phosphorylation |
| 15109498 |
247 | S | ubiquitylation |
| 15109498 |
251 | S | Phosphorylation |
| 15109498 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATF4_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DAPK3_HUMAN | DAPK3 | physical | 9488481 | |
DAPK3_MOUSE | Dapk3 | physical | 9488481 | |
FOS_MOUSE | Fos | physical | 20211142 | |
JUN_MOUSE | Jun | physical | 20211142 | |
GABR1_MOUSE | Gabbr1 | physical | 15013631 | |
GABR2_MOUSE | Gabbr2 | physical | 15013631 | |
ABRX2_MOUSE | Fam175b | physical | 22974638 | |
SATB2_MOUSE | Satb2 | physical | 16751105 | |
TRIB3_MOUSE | Trib3 | physical | 12749859 | |
HIF1A_MOUSE | Hif1a | physical | 23649506 | |
EGLN3_MOUSE | Egln3 | physical | 23649506 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...