UniProt ID | AAD15_YEAST | |
---|---|---|
UniProt AC | Q08361 | |
Protein Name | Putative aryl-alcohol dehydrogenase AAD15 | |
Gene Name | AAD15 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 143 | |
Subcellular Localization | ||
Protein Description | Putative aryl-alcohol dehydrogenase.. | |
Protein Sequence | MARHFGMALAPWDVMGGGRFQSKKAMEERRKNGECIRSFVGASEQTDAEIKISEALAKVAEEHGTESVTAIAIAYVRSKAKNVFPSVEGGKIEDLKENIKALSIDLTPDNIKYLENVVPFDIGFPNTFIVLNSLTQKYGTNNV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of AAD15_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AAD15_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AAD15_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AAD15_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RL8A_YEAST | RPL8A | genetic | 27708008 | |
RIM1_YEAST | RIM1 | genetic | 27708008 | |
RM01_YEAST | MRPL1 | genetic | 27708008 | |
INO2_YEAST | INO2 | genetic | 27708008 | |
SPS2_YEAST | SPS2 | genetic | 27708008 | |
YGY5_YEAST | YGL235W | genetic | 27708008 | |
RTG2_YEAST | RTG2 | genetic | 27708008 | |
TBP7_YEAST | YTA7 | genetic | 27708008 | |
AIM18_YEAST | AIM18 | genetic | 27708008 | |
UBL1_YEAST | YUH1 | genetic | 27708008 | |
DPH2_YEAST | DPH2 | genetic | 27708008 | |
GYS2_YEAST | GSY2 | genetic | 27708008 | |
AEP2_YEAST | AEP2 | genetic | 27708008 | |
CPT1_YEAST | CPT1 | genetic | 27708008 | |
LCF1_YEAST | FAA1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...