UniProt ID | YQFD_SCHPO | |
---|---|---|
UniProt AC | O94405 | |
Protein Name | Uncharacterized protein C126.13c | |
Gene Name | SPCC126.13c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 145 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MDIRESRSQSPELSQSEDAVGPCPFLISVYHQFQTKNHVLDIFEDVIPSIQVYGWLTMTLYELGVLIADQLLLNNEETRHSEWSLQIRTIFYDKYKDRPIARDLGTVCLHNPKLFQGNKLLKRTGIKCGDKIDVTIKEDKIRIKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MDIRESRSQSPELSQ CCHHHHHCCCCCCCC | 44.27 | 25720772 | |
10 | Phosphorylation | IRESRSQSPELSQSE HHHHHCCCCCCCCCC | 22.91 | 29996109 | |
14 | Phosphorylation | RSQSPELSQSEDAVG HCCCCCCCCCCCCCC | 29.96 | 29996109 | |
16 | Phosphorylation | QSPELSQSEDAVGPC CCCCCCCCCCCCCCC | 33.78 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YQFD_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YQFD_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YQFD_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAF1_SCHPO | raf1 | genetic | 18818364 | |
URK1_SCHPO | SPCC162.11c | genetic | 18818364 | |
RL1DA_SCHPO | SPCC306.07c | genetic | 18818364 | |
AGO1_SCHPO | ago1 | genetic | 18818364 | |
RYH1_SCHPO | ryh1 | genetic | 22681890 | |
SFT1_SCHPO | sft1 | genetic | 22681890 | |
CTBL1_SCHPO | SPAC1952.06c | genetic | 22681890 | |
YNSG_SCHPO | can1 | genetic | 22681890 | |
SNF5_SCHPO | snf5 | genetic | 22681890 | |
COM1_SCHPO | ctp1 | genetic | 22681890 | |
HMT2_SCHPO | hmt2 | genetic | 22681890 | |
SEC14_SCHPO | spo20 | genetic | 22681890 | |
SDE2_SCHPO | sde2 | genetic | 22681890 | |
YKN4_SCHPO | mca1 | genetic | 22681890 | |
OMH6_SCHPO | omh6 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...