UniProt ID | YPEL1_HUMAN | |
---|---|---|
UniProt AC | O60688 | |
Protein Name | Protein yippee-like 1 | |
Gene Name | YPEL1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 119 | |
Subcellular Localization | Nucleus. | |
Protein Description | May play a role in epithelioid conversion of fibroblasts.. | |
Protein Sequence | MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | Phosphorylation | QGSQGRAYLFNSVVN CCCCHHEEEECCEEE | 15.51 | 28387310 | |
69 | Phosphorylation | AEERVLLTGLHAVAD HHHHHHHHHHHHHEE | 33.27 | 28387310 | |
90 | Phosphorylation | KTTLGWKYEHAFESS CCCCCCCCEECHHCC | 13.36 | 22817900 | |
100 | Phosphorylation | AFESSQKYKEGKFII CHHCCHHHHCCCCHH | 13.46 | 29396449 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YPEL1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YPEL1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YPEL1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CT2NL_HUMAN | CTTNBP2NL | physical | 28514442 | |
FXL20_HUMAN | FBXL20 | physical | 28514442 | |
FBXL2_HUMAN | FBXL2 | physical | 28514442 | |
STRN4_HUMAN | STRN4 | physical | 28514442 | |
STRP1_HUMAN | STRIP1 | physical | 28514442 | |
STRN3_HUMAN | STRN3 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...