YPEL1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YPEL1_HUMAN
• UniProt AC: O60688
• Protein Name: Protein yippee-like 1
• Gene Name: YPEL1
• Organism: Homo sapiens (Human).
• Sequence Length: 119
• Subcellular Localization: Nucleus.
• Protein Description: May play a role in epithelioid conversion of fibroblasts..
• Protein Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
49	Phosphorylation	QGSQGRAYLFNSVVN CCCCHHEEEECCEEE	15.51	28387310
69	Phosphorylation	AEERVLLTGLHAVAD HHHHHHHHHHHHHEE	33.27	28387310
90	Phosphorylation	KTTLGWKYEHAFESS CCCCCCCCEECHHCC	13.36	22817900
100	Phosphorylation	AFESSQKYKEGKFII CHHCCHHHHCCCCHH	13.46	29396449

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YPEL1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YPEL1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YPEL1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CT2NL_HUMAN	CTTNBP2NL	physical	28514442
FXL20_HUMAN	FBXL20	physical	28514442
FBXL2_HUMAN	FBXL2	physical	28514442
STRN4_HUMAN	STRN4	physical	28514442
STRP1_HUMAN	STRIP1	physical	28514442
STRN3_HUMAN	STRN3	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.