dbPTM

YN60_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YN60_YEAST
UniProt AC	P42840
Protein Name	Uncharacterized membrane protein YNL320W
Gene Name	YNL320W
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	284
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description
Protein Sequence	MLWKVSKMFLGGLVALTTISVATLYHYQNRLVYPSWAQGARNHVDTPDSRGIPYEKLTLITQDHIKLEAWDIKNENSTSTVLILCPNAGNIGYFILIIDIFYRQFGMSVFIYSYRGYGNSEGSPSEKGLKLDADCVISHLSTDSFHSKRKLVLYGRSLGGANALYIASKFRDLCDGVILENTFLSIRKVIPYIFPLLKRFTLLCHEIWNSEGLMGSCSSETPFLFLSGLKDEIVPPFHMRKLYETCPSSNKKIFEFPLGSHNDTIIQDGYWDIIRDFLIEKGFI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
46	Phosphorylation	GARNHVDTPDSRGIP CHHHCCCCCCCCCCC	28.10	28889911
49	Phosphorylation	NHVDTPDSRGIPYEK HCCCCCCCCCCCHHH	33.34	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YN60_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YN60_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YN60_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VMA21_YEAST	VMA21	genetic	27708008
HEK2_YEAST	HEK2	genetic	27708008
GFD2_YEAST	GFD2	genetic	27708008
MNN10_YEAST	MNN10	genetic	27708008
SCY1_YEAST	SCY1	genetic	27708008
TNA1_YEAST	TNA1	genetic	27708008
YIU0_YEAST	YIR020C	genetic	27708008
VPS53_YEAST	VPS53	genetic	27708008
ILM1_YEAST	ILM1	genetic	27708008
SIC1_YEAST	SIC1	genetic	27708008
FKS1_YEAST	FKS1	genetic	27708008
SFL1_YEAST	SFL1	genetic	27708008
ALDH6_YEAST	ALD6	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YN60_YEAST

Related Literatures of Post-Translational Modification