| UniProt ID | YF9E_SCHPO | |
|---|---|---|
| UniProt AC | O42653 | |
| Protein Name | ABC1 family protein C10F6.14c | |
| Gene Name | SPAC10F6.14c | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 535 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MLTSWRTISLLQKTTSRFIKRSKTYADVRYNSQALQNHGVPGNKRKWMKRFVFVGAAGIGVYAWDRVYNAHALTRSIRTVYTASIIAADYKLNFSEKKADKIDALHQRVAQRLFKTIYKNGGLYIKMGQIIAMQSNNLPEAYGKAFQGMFDNAPQVEWEELQDIFKEQYGRPVEEVFASIEKRAAASASIAQVHRAVLPSGEKVAVKIQKPDVAKQMSWDLLVYKYMMYVYDKWIFHIPLYFTVDYVSERLRSEVDFTTEANNSEHAREGVEETDYLRDKIYIPKVYKEISGKRVMVTEWADGIPLYDQTALSEAGMSKKEILTNLFRFLAFQMFHSKQVHCDPHPGNILVRKNQAGLCQTVILDHGLYVFESEKFRKEFALLFTAAYSLDKKSILQVMDAWGIGQPELFANRMLNIPMDEEQPHTGEKIISKKEAFQQQLAERKKFIGFLQDCTRLPKELLMLGRCLMLIQKNNQNFGYPVNSIAVMAKVADKYTTDKPSPTWYQRLLSPIFWVFQHLFYPGNFRLPELTNDKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YF9E_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YF9E_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YF9E_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YF9E_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| YG58_SCHPO | SPBC56F2.08c | genetic | 22681890 | |
| YNU4_SCHPO | SPBC28E12.04 | genetic | 22681890 | |
| ARF6_SCHPO | arf6 | genetic | 22681890 | |
| BCA1_SCHPO | eca39 | genetic | 22681890 | |
| YBPC_SCHPO | SPBC16H5.12c | genetic | 22681890 | |
| COQ10_SCHPO | coq10 | genetic | 22681890 | |
| RM39_SCHPO | mrpl39 | genetic | 22681890 | |
| RDH54_SCHPO | rdh54 | genetic | 22681890 | |
| MED1_SCHPO | pmc2 | genetic | 22681890 | |
| TOM70_SCHPO | tom70 | genetic | 22681890 | |
| SKI3_SCHPO | SPCC1919.05 | genetic | 22681890 | |
| YA99_SCHPO | SPAC13G6.09 | genetic | 22681890 | |
| YNK4_SCHPO | SPBC29B5.04c | genetic | 22681890 | |
| SSN2_SCHPO | med13 | genetic | 22681890 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...