dbPTM

YB230_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YB230_YEAST
UniProt AC	Q3E762
Protein Name	Putative uncharacterized protein YBR230W-A
Gene Name	YBR230W-A
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	66
Subcellular Localization
Protein Description
Protein Sequence	MRNELYQLWCVASAARGVAKSSFVRANSAMCEYVRTSNVLSRWTRDRQWEAAKALSQRVKKEYAAN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YB230_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YB230_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YB230_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YB230_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MET30_YEAST	MET30	genetic	27708008
PSB3_YEAST	PUP3	genetic	27708008
RPN11_YEAST	RPN11	genetic	27708008
BRL1_YEAST	BRL1	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
SEC23_YEAST	SEC23	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YB230_YEAST

Related Literatures of Post-Translational Modification