| UniProt ID | WRK36_ARATH | |
|---|---|---|
| UniProt AC | Q9CAR4 | |
| Protein Name | Probable WRKY transcription factor 36 | |
| Gene Name | WRKY36 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 387 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity).. | |
| Protein Sequence | MIKEETVSYFQTFDGVMAESDKEEELDATKAKVEKVREENEKLKLLLSTILNNYNSLQMQVSKVLGQQQGASSMELDHIDRQDENNDYDVDISLRLGRSEQKISKKEENKVDKISTKNVEESKDKRSALGFGFQIQSYEASKLDDLCRQVKLANAENKCVSSRKDVKSVRNENHQDVLEEHEQTGLKKTRVCVKASCEDPSINDGCQWRKYGQKTAKTNPLPRAYYRCSMSSNCPVRKQVQRCGEEETSAFMTTYEGNHDHPLPMEASHMAAGTSAAASLLQSGSSSSSSSTSASLSYFFPFHHFSISTTNSHPTVTLDLTRPNYPNQLPDDYPLSSSSFSLNFSSPDPPPPSSHDHTLNFSGLRTQAPLSTDSLLARYRTRLSGQQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MIKEETVSYFQTF --CCCHHHHHHHEEC | 18.82 | 24894044 | |
| 8 | Phosphorylation | MIKEETVSYFQTFDG CCCHHHHHHHEECCC | 27.87 | 24894044 | |
| 12 | Phosphorylation | ETVSYFQTFDGVMAE HHHHHHEECCCEECC | 17.50 | 24894044 | |
| 20 | Phosphorylation | FDGVMAESDKEEELD CCCEECCCCCHHHHH | 44.43 | 24894044 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WRK36_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WRK36_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WRK36_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| WRK36_ARATH | WRKY36 | physical | 21798944 | |
| TCP14_ARATH | TCP14 | physical | 21798944 | |
| GRS16_ARATH | CXIP2 | physical | 21798944 | |
| WRK60_ARATH | WRKY60 | physical | 21798944 | |
| TCP13_ARATH | PTF1 | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...