dbPTM

WRK36_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	WRK36_ARATH
UniProt AC	Q9CAR4
Protein Name	Probable WRKY transcription factor 36
Gene Name	WRKY36
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	387
Subcellular Localization	Nucleus .
Protein Description	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity)..
Protein Sequence	MIKEETVSYFQTFDGVMAESDKEEELDATKAKVEKVREENEKLKLLLSTILNNYNSLQMQVSKVLGQQQGASSMELDHIDRQDENNDYDVDISLRLGRSEQKISKKEENKVDKISTKNVEESKDKRSALGFGFQIQSYEASKLDDLCRQVKLANAENKCVSSRKDVKSVRNENHQDVLEEHEQTGLKKTRVCVKASCEDPSINDGCQWRKYGQKTAKTNPLPRAYYRCSMSSNCPVRKQVQRCGEEETSAFMTTYEGNHDHPLPMEASHMAAGTSAAASLLQSGSSSSSSSTSASLSYFFPFHHFSISTTNSHPTVTLDLTRPNYPNQLPDDYPLSSSSFSLNFSSPDPPPPSSHDHTLNFSGLRTQAPLSTDSLLARYRTRLSGQQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MIKEETVSYFQTF --CCCHHHHHHHEEC	18.82	24894044
8	Phosphorylation	MIKEETVSYFQTFDG CCCHHHHHHHEECCC	27.87	24894044
12	Phosphorylation	ETVSYFQTFDGVMAE HHHHHHEECCCEECC	17.50	24894044
20	Phosphorylation	FDGVMAESDKEEELD CCCEECCCCCHHHHH	44.43	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of WRK36_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of WRK36_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of WRK36_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
WRK36_ARATH	WRKY36	physical	21798944
TCP14_ARATH	TCP14	physical	21798944
GRS16_ARATH	CXIP2	physical	21798944
WRK60_ARATH	WRKY60	physical	21798944
TCP13_ARATH	PTF1	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of WRK36_ARATH

Related Literatures of Post-Translational Modification