UniProt ID | VPX_SIVG1 | |
---|---|---|
UniProt AC | Q02842 | |
Protein Name | Protein Vpx | |
Gene Name | vpx | |
Organism | Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) (SIV-agm.gri) (Simian immunodeficiency virus African green monkey grivet). | |
Sequence Length | 118 | |
Subcellular Localization | Virion. Host nucleus. Nuclear just after virion uncoating, or if expressed in the absence of unprocessed GAG.. | |
Protein Description | Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription (By similarity).. | |
Protein Sequence | MASGRDPREPLPGWLEIWDLDREPWDEWLQDMLRDLNEEARRHFGMNMLIRVWNYCVEEGRRHNTPWNEIGYKYYRIVQKSMFVHFRCGCRRRGPFSPYEERRNGQGGGAPPPPPGLA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of VPX_SIVG1 !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPX_SIVG1 !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPX_SIVG1 !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPX_SIVG1 !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DCAF1_HUMAN | VPRBP | physical | 21696578 | |
DDB1_HUMAN | DDB1 | physical | 18464893 | |
DCAF1_HUMAN | VPRBP | physical | 18464893 | |
DDA1_HUMAN | DDA1 | physical | 18464893 | |
CUL4A_HUMAN | CUL4A | physical | 18464893 | |
SAMH1_HUMAN | SAMHD1 | physical | 23677995 | |
DDB1_HUMAN | DDB1 | physical | 23677995 | |
DCAF1_HUMAN | VPRBP | physical | 23677995 | |
SAMH1_HUMAN | SAMHD1 | physical | 26779819 | |
SAMH1_CHICK | SAMHD1 | physical | 26779819 | |
SAMH1_HUMAN | SAMHD1 | physical | 28202763 | |
DCAF1_HUMAN | VPRBP | physical | 28202763 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...