VPS2A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VPS2A_ARATH
• UniProt AC: Q9SKI2
• Protein Name: Vacuolar protein sorting-associated protein 2 homolog 1
• Gene Name: VPS2.1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 225
• Subcellular Localization: Endosome.
• Protein Description: Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo (By similarity)..
• Protein Sequence: MMNSIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAKQGQMGAVKVMAKDLIRTRHQIEKFYKLKSQLQGVSLRIQTLKSTQAMGEAMKGVTKAMGQMNRQMNLPSLQKIMQEFERQNEKMEMVSEVMGDAIDDALEGDEEEEETEDLVSQVLDEIGIDINQELVNAPSGAVAVPAAKNKVVQAEATGAEDSGGIDSDLQARLDNLRKM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of VPS2A_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VPS2A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VPS2A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VPS2A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELCL_ARATH	ELC-Like	physical	21442383
VP241_ARATH	VPS24.1	physical	21442383
VP282_ARATH	VPS28-2	physical	21442383
VP371_ARATH	VPS37-1	physical	21442383
VPS36_ARATH	AT5G04920	physical	21442383
AMSH3_ARATH	AMSH3	physical	21810997
VPS2B_ARATH	VPS2.2	physical	22010978
AMSH1_ARATH	AMSH1	physical	23800962

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.