AMSH1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AMSH1_ARATH
• UniProt AC: Q8VYB5
• Protein Name: AMSH-like ubiquitin thioesterase 1
• Gene Name: AMSH1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 507
• Subcellular Localization: Membrane; Peripheral membrane protein. Cytoplasm.
• Protein Description: Zinc metalloprotease that cleaves 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains..
• Protein Sequence: MGSSFETIDIATSARRIGVDNRISLKFYFRIADNILKQANIFRAEKNVIDLYVMLLRFSSLALETIPSHRDYRTSLKSNKEYLRMRLLDVLTELEKLKPVVQQRIDELYPKLKPRYNVQAHPANGSLGWSSAVKPSFNSYDHAKVRNPPGHNSGYMGSRGQQFLNAAPLEERFRKMSVNFRPNEETLSKHSILGPGGLSAQWQPPKYDTKVQYPSNIDFSPVVIPSFQQLVDSKPMITNGSNDEPEKPIVEPSVASNEKIQKNYTEELSSMISFEEPESVNENNLIRQPSPPPVLAEVQDLVPALCPEVREPECMIENSLPDESLRSESPLELHIATSMMDTFMRLAKSNTKKNLETCGILAGSLKNRKFYITALIIPKQESTSDSCQATNEEEIFEVQDKQSLFPLGWIHTHPTQSCFMSSIDVHTHYSYQIMLPEAVAIVMAPQDSSRNHGIFRLTTPGGMTVIRNCDRRGFHAHSSPEDGGPIYNTCKEVYMNPNLKFDVIDLR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
290	Phosphorylation	NNLIRQPSPPPVLAE CCCCCCCCCCCCHHH	41.52	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AMSH1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AMSH1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AMSH1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBQ3_ARATH	UBQ3	physical	23800962
VPS2A_ARATH	VPS2.1	physical	23800962

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.