UniProt ID | VP371_ARATH | |
---|---|---|
UniProt AC | Q9SCP9 | |
Protein Name | Vacuolar protein-sorting-associated protein 37 homolog 1 | |
Gene Name | VPS37-1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 217 | |
Subcellular Localization | Endosome. | |
Protein Description | Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs) (By similarity).. | |
Protein Sequence | MFNFWGSKDQQQGQSRPQEASSQSPWYSPSLVSSPSSSRPQSSGQISAQVSPGEAAGIIVFLKDKSVDELRKLLSDKDAYQQFLLSLDQVKVQNNIKDELRRETLQLARDNLEKEPQIMELRNQCRIIRTTELATAQEKLNELERQKEEILKFYSPGSLLHKLQEAMNQVDEESEALQEKFLEKEIDTAAFVQKYKKLRTTYHRRALIHLAAKTSNI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of VP371_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VP371_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VP371_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VP371_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ELC_ARATH | ELC | physical | 21442383 | |
ELCL_ARATH | ELC-Like | physical | 21442383 | |
VP281_ARATH | VPS28-1 | physical | 21442383 | |
VP371_ARATH | VPS37-1 | physical | 21442383 | |
VPS2A_ARATH | VPS2.1 | physical | 21442383 | |
ELC_ARATH | ELC | physical | 22639582 | |
ELCL_ARATH | ELC-Like | physical | 22639582 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...