VP371_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VP371_ARATH
• UniProt AC: Q9SCP9
• Protein Name: Vacuolar protein-sorting-associated protein 37 homolog 1
• Gene Name: VPS37-1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 217
• Subcellular Localization: Endosome.
• Protein Description: Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs) (By similarity)..
• Protein Sequence: MFNFWGSKDQQQGQSRPQEASSQSPWYSPSLVSSPSSSRPQSSGQISAQVSPGEAAGIIVFLKDKSVDELRKLLSDKDAYQQFLLSLDQVKVQNNIKDELRRETLQLARDNLEKEPQIMELRNQCRIIRTTELATAQEKLNELERQKEEILKFYSPGSLLHKLQEAMNQVDEESEALQEKFLEKEIDTAAFVQKYKKLRTTYHRRALIHLAAKTSNI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of VP371_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VP371_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VP371_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VP371_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELC_ARATH	ELC	physical	21442383
ELCL_ARATH	ELC-Like	physical	21442383
VP281_ARATH	VPS28-1	physical	21442383
VP371_ARATH	VPS37-1	physical	21442383
VPS2A_ARATH	VPS2.1	physical	21442383
ELC_ARATH	ELC	physical	22639582
ELCL_ARATH	ELC-Like	physical	22639582

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.