| UniProt ID | VP241_ARATH | |
|---|---|---|
| UniProt AC | Q9FFB3 | |
| Protein Name | Vacuolar protein sorting-associated protein 24 homolog 1 | |
| Gene Name | VPS24-1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 229 | |
| Subcellular Localization | Endosome. | |
| Protein Description | Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo (By similarity).. | |
| Protein Sequence | MERVMNIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMVSAKALAKEIVSSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMKAPQMAATMQEFSKEMTKAGVIEEFVNEAIDNALDSEDMEEEIDEEVDKVLTAIAGETAAELPVAVRKERIKVPAQKASTSREEEAVAEGVDDEEELEEIRARLAKVRS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 96 | Phosphorylation | ISMHLGESVAIARTV HHHHHHHHHHHHHHH | 18.30 | 24894044 | |
| 128 | Phosphorylation | KAPQMAATMQEFSKE HHHHHHHHHHHHHHH | 15.17 | 24894044 | |
| 133 | Phosphorylation | AATMQEFSKEMTKAG HHHHHHHHHHHHHHH | 27.27 | 24894044 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VP241_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VP241_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VP241_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VP321_ARATH | SNF7.2 | physical | 21442383 | |
| VP202_ARATH | VPS20.2 | physical | 21442383 | |
| VP201_ARATH | VPS20.1 | physical | 21442383 | |
| VP322_ARATH | SNF7.1 | physical | 21442383 | |
| AMSH3_ARATH | AMSH3 | physical | 21810997 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...