UniProt ID | VP241_ARATH | |
---|---|---|
UniProt AC | Q9FFB3 | |
Protein Name | Vacuolar protein sorting-associated protein 24 homolog 1 | |
Gene Name | VPS24-1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 229 | |
Subcellular Localization | Endosome. | |
Protein Description | Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo (By similarity).. | |
Protein Sequence | MERVMNIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMVSAKALAKEIVSSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMKAPQMAATMQEFSKEMTKAGVIEEFVNEAIDNALDSEDMEEEIDEEVDKVLTAIAGETAAELPVAVRKERIKVPAQKASTSREEEAVAEGVDDEEELEEIRARLAKVRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
96 | Phosphorylation | ISMHLGESVAIARTV HHHHHHHHHHHHHHH | 18.30 | 24894044 | |
128 | Phosphorylation | KAPQMAATMQEFSKE HHHHHHHHHHHHHHH | 15.17 | 24894044 | |
133 | Phosphorylation | AATMQEFSKEMTKAG HHHHHHHHHHHHHHH | 27.27 | 24894044 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VP241_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VP241_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VP241_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VP321_ARATH | SNF7.2 | physical | 21442383 | |
VP202_ARATH | VPS20.2 | physical | 21442383 | |
VP201_ARATH | VPS20.1 | physical | 21442383 | |
VP322_ARATH | SNF7.1 | physical | 21442383 | |
AMSH3_ARATH | AMSH3 | physical | 21810997 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...