dbPTM

VP241_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VP241_ARATH
UniProt AC	Q9FFB3
Protein Name	Vacuolar protein sorting-associated protein 24 homolog 1
Gene Name	VPS24-1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	229
Subcellular Localization	Endosome.
Protein Description	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo (By similarity)..
Protein Sequence	MERVMNIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMVSAKALAKEIVSSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMKAPQMAATMQEFSKEMTKAGVIEEFVNEAIDNALDSEDMEEEIDEEVDKVLTAIAGETAAELPVAVRKERIKVPAQKASTSREEEAVAEGVDDEEELEEIRARLAKVRS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
96	Phosphorylation	ISMHLGESVAIARTV HHHHHHHHHHHHHHH	18.30	24894044
128	Phosphorylation	KAPQMAATMQEFSKE HHHHHHHHHHHHHHH	15.17	24894044
133	Phosphorylation	AATMQEFSKEMTKAG HHHHHHHHHHHHHHH	27.27	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VP241_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VP241_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VP241_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VP321_ARATH	SNF7.2	physical	21442383
VP202_ARATH	VPS20.2	physical	21442383
VP201_ARATH	VPS20.1	physical	21442383
VP322_ARATH	SNF7.1	physical	21442383
AMSH3_ARATH	AMSH3	physical	21810997

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VP241_ARATH

Related Literatures of Post-Translational Modification