UniProt ID | VP201_ARATH | |
---|---|---|
UniProt AC | Q8GXN6 | |
Protein Name | Vacuolar protein sorting-associated protein 20 homolog 1 | |
Gene Name | VPS20.1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 219 | |
Subcellular Localization | Endosome. | |
Protein Description | Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo (By similarity).. | |
Protein Sequence | MGNLFVKKPQITEVDRAILSLKTQRRKLGQYQQKLEKVIEAEKQAARDLIREKRKDRALLALRKKRTQEELLKQVDQWVINVEQQLTDIELTSKQKAVFESLKQGNSAIKAIQSELDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEDILAEFDNLESQLIVDEMPEVPTKESEESEKLDLPDVPTKTPVASNAEITPAESATKTKVLEEPLPA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
114 | Phosphorylation | SAIKAIQSELDLDDV HHHHHHHHHCCHHHH | 33.73 | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VP201_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VP201_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VP201_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VPS25_ARATH | VPS25 | physical | 21442383 | |
VPS36_ARATH | AT5G04920 | physical | 21442383 | |
VP321_ARATH | SNF7.2 | physical | 21442383 | |
VP202_ARATH | VPS20.2 | physical | 21442383 | |
VP201_ARATH | VPS20.1 | physical | 21442383 | |
VPS2C_ARATH | VPS2.3 | physical | 21442383 | |
VP241_ARATH | VPS24.1 | physical | 21442383 | |
VP322_ARATH | SNF7.1 | physical | 21442383 | |
VPS36_ARATH | AT5G04920 | physical | 22639582 | |
VP201_ARATH | VPS20.1 | physical | 22639582 | |
VPS25_ARATH | VPS25 | physical | 22639582 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...