dbPTM

VP201_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VP201_ARATH
UniProt AC	Q8GXN6
Protein Name	Vacuolar protein sorting-associated protein 20 homolog 1
Gene Name	VPS20.1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	219
Subcellular Localization	Endosome.
Protein Description	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo (By similarity)..
Protein Sequence	MGNLFVKKPQITEVDRAILSLKTQRRKLGQYQQKLEKVIEAEKQAARDLIREKRKDRALLALRKKRTQEELLKQVDQWVINVEQQLTDIELTSKQKAVFESLKQGNSAIKAIQSELDLDDVQKLMDDTADAKAYQDELNAILGEKLSAEDEEDILAEFDNLESQLIVDEMPEVPTKESEESEKLDLPDVPTKTPVASNAEITPAESATKTKVLEEPLPA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
114	Phosphorylation	SAIKAIQSELDLDDV HHHHHHHHHCCHHHH	33.73	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VP201_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VP201_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VP201_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VPS25_ARATH	VPS25	physical	21442383
VPS36_ARATH	AT5G04920	physical	21442383
VP321_ARATH	SNF7.2	physical	21442383
VP202_ARATH	VPS20.2	physical	21442383
VP201_ARATH	VPS20.1	physical	21442383
VPS2C_ARATH	VPS2.3	physical	21442383
VP241_ARATH	VPS24.1	physical	21442383
VP322_ARATH	SNF7.1	physical	21442383
VPS36_ARATH	AT5G04920	physical	22639582
VP201_ARATH	VPS20.1	physical	22639582
VPS25_ARATH	VPS25	physical	22639582

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VP201_ARATH

Related Literatures of Post-Translational Modification