| UniProt ID | VPS25_ARATH | |
|---|---|---|
| UniProt AC | Q8VZC9 | |
| Protein Name | Vacuolar protein sorting-associated protein 25 | |
| Gene Name | VPS25 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 179 | |
| Subcellular Localization | Endosome. | |
| Protein Description | Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex (By similarity).. | |
| Protein Sequence | MQKLADFKLPQFFNYPPYFTLQPVRDTREKQIQLWKELILDYCKSQKIFLIGVEEDFPLFSNSAIDRSLSHEARETFLSAIVGEGRAEWLDKGHRKCLILWHRIQDWADIVLQFVRDNGLEDSVMTVEEIRSGTESLGTELQGIDRTILMRALKLLENKGKLALFKGTSADDEGVKFSV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of VPS25_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPS25_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPS25_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPS25_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VP221_ARATH | VPS22 | physical | 21442383 | |
| VP201_ARATH | VPS20.1 | physical | 21442383 | |
| VP202_ARATH | VPS20.2 | physical | 21442383 | |
| VP202_ARATH | VPS20.2 | physical | 21798944 | |
| ELCL_ARATH | ELC-Like | physical | 22639582 | |
| VP221_ARATH | VPS22 | physical | 22639582 | |
| VPS36_ARATH | AT5G04920 | physical | 22639582 | |
| VP202_ARATH | VPS20.2 | physical | 22639582 | |
| VP201_ARATH | VPS20.1 | physical | 22639582 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...