VPS25_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VPS25_ARATH
• UniProt AC: Q8VZC9
• Protein Name: Vacuolar protein sorting-associated protein 25
• Gene Name: VPS25
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 179
• Subcellular Localization: Endosome.
• Protein Description: Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex (By similarity)..
• Protein Sequence: MQKLADFKLPQFFNYPPYFTLQPVRDTREKQIQLWKELILDYCKSQKIFLIGVEEDFPLFSNSAIDRSLSHEARETFLSAIVGEGRAEWLDKGHRKCLILWHRIQDWADIVLQFVRDNGLEDSVMTVEEIRSGTESLGTELQGIDRTILMRALKLLENKGKLALFKGTSADDEGVKFSV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of VPS25_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VPS25_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VPS25_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VPS25_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VP221_ARATH	VPS22	physical	21442383
VP201_ARATH	VPS20.1	physical	21442383
VP202_ARATH	VPS20.2	physical	21442383
VP202_ARATH	VPS20.2	physical	21798944
ELCL_ARATH	ELC-Like	physical	22639582
VP221_ARATH	VPS22	physical	22639582
VPS36_ARATH	AT5G04920	physical	22639582
VP202_ARATH	VPS20.2	physical	22639582
VP201_ARATH	VPS20.1	physical	22639582

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.