VE6_HPV16 - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VE6_HPV16
• UniProt AC: P03126
• Protein Name: Protein E6 {ECO:0000255|HAMAP-Rule:MF_04006}
• Gene Name: E6 {ECO:0000255|HAMAP-Rule:MF_04006}
• Organism: Human papillomavirus type 16.
• Sequence Length: 158
• Subcellular Localization: Host cytoplasm . Host nucleus .
• Protein Description: Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting them to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6AP targets several other substrates to degradation via the proteasome including host DLG1 or NFX1, a repressor of human telomerase reverse transcriptase (hTERT). The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including BAK1, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway..
• Protein Sequence: MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of VE6_HPV16 !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VE6_HPV16 !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VE6_HPV16 !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VE6_HPV16 !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBE3A_HUMAN	UBE3A	physical	26789255
P53_HUMAN	TP53	physical	26789255
CBP_HUMAN	CREBBP	physical	10487758
EP300_HUMAN	EP300	physical	10487758
UBE3A_HUMAN	UBE3A	physical	26915086

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.