UniProt ID | VATF1_DROME | |
---|---|---|
UniProt AC | Q24583 | |
Protein Name | V-type proton ATPase subunit F 1 | |
Gene Name | Vha14-1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 124 | |
Subcellular Localization | ||
Protein Description | Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.. | |
Protein Sequence | MALHSAIKGKLISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVSELEDCFKRFLKRDDIDIILINQNCAELIRHVIDAHTSPVPAVLEIPSKDHPYDASKDSILRRARGMFNPEDLVR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VATF1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VATF1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VATF1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VATE_DROME | Vha26 | physical | 22036573 | |
VATD1_DROME | Vha36-1 | physical | 22036573 | |
VA0D1_DROME | VhaAC39-1 | physical | 22036573 | |
VATC_DROME | Vha44 | physical | 22036573 | |
VATA2_DROME | Vha68-2 | physical | 22036573 | |
VATA1_DROME | Vha68-1 | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...