| UniProt ID | VASH1_HUMAN | |
|---|---|---|
| UniProt AC | Q7L8A9 | |
| Protein Name | Vasohibin-1 | |
| Gene Name | VASH1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 365 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Angiogenesis inhibitor. Inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. Does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. Acts in an autocrine manner. Inhibits artery neointimal formation and macrophage infiltration. Exhibits heparin-binding activity.. | |
| Protein Sequence | MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPDLNGYQIRV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 23 | Phosphorylation | TPTSAAATAPSGVRR CCCCHHHCCCCCCEE | 34.08 | 22468782 | |
| 38 | Phosphorylation | LETSEGTSAQRDEEP EECCCCCCCCCCCCC | 33.01 | - | |
| 146 | Methylation | TQFFEIKKSRPLTGL CEEEEEECCCCCCCH | 58.31 | - | |
| 192 | Phosphorylation | TLERFPISFKTYFSG CCCCCCCCEEEEECC | 22.41 | 24719451 | |
| 309 | Phosphorylation | RLKIGKGTGPPSPTK HHHCCCCCCCCCCCC | 50.42 | 23403867 | |
| 313 | Phosphorylation | GKGTGPPSPTKDRKK CCCCCCCCCCCCCCC | 48.62 | 24972180 | |
| 315 | Phosphorylation | GTGPPSPTKDRKKDV CCCCCCCCCCCCCCC | 50.33 | 23403867 | |
| 330 | Phosphorylation | SSPQRAQSSPHRRNS CCCHHHHCCCCCCCC | 44.87 | 23911959 | |
| 331 | Phosphorylation | SPQRAQSSPHRRNSR CCHHHHCCCCCCCCC | 16.79 | 23911959 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VASH1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VASH1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VASH1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SVBP_HUMAN | CCDC23 | physical | 20736312 | |
| HSP7C_HUMAN | HSPA8 | physical | 26186194 | |
| HSP76_HUMAN | HSPA6 | physical | 26186194 | |
| HS71L_HUMAN | HSPA1L | physical | 26186194 | |
| RAB6B_HUMAN | RAB6B | physical | 28514442 | |
| PAXX_HUMAN | C9orf142 | physical | 28514442 | |
| GDS1_HUMAN | RAP1GDS1 | physical | 28514442 | |
| RHOA_HUMAN | RHOA | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
