UniProt ID | SVBP_HUMAN | |
---|---|---|
UniProt AC | Q8N300 | |
Protein Name | Small vasohibin-binding protein {ECO:0000303|PubMed:20736312} | |
Gene Name | SVBP {ECO:0000303|PubMed:20736312} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 66 | |
Subcellular Localization | Secreted . Detected both intracellularly and extracellularly. Within cells, localizes mainly to the apical part of the cell. | |
Protein Description | Enhances the solubility and secretion of VASH1 and prevents its ubiquitination. Also enhances secretion of VASH2.. | |
Protein Sequence | MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Ubiquitination | RKEKTKVKESVSRVE HHHHHHHHHHHHHHH | 24816145 | ||
23 | Ubiquitination | VSRVEKAKQKSAQQE HHHHHHHHHHHHHHH | 24816145 | ||
40 | Phosphorylation | QRQRAEIYALNRVMT HHHHHHHHHHHHHHH | 21945579 | ||
46 | Sulfoxidation | IYALNRVMTELEQQQ HHHHHHHHHHHHHHH | 21406390 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SVBP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SVBP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SVBP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VASH1_HUMAN | VASH1 | physical | 20736312 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...