dbPTM

ULI1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ULI1_YEAST
UniProt AC	P43604
Protein Name	Unfolded protein response-inducible protein 1
Gene Name	ULI1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	169
Subcellular Localization
Protein Description	Involved in the unfolded protein response (UPR), a transcriptional response which up-regulates genes that enable cells to cope with misfolded, endoplasmic reticulum-retained proteins. UPR is part of the endoplasmic reticulum quality control (ERQC) which prevents the exit of misfolded secretory and membrane proteins from the endoplasmic reticulum..
Protein Sequence	MTPYAVAITVALLIVTVSALQVNNSCVAFPPSNLRGKNGDGTNEQYATALLSIPWNGPPESLRDINLIELEPQVALYLLENYINHYYNTTRDNKCPNNHYLMGGQLGSSSDNRSLNDPQTMLWPEKKEDEKNCQETFKGACSCTKRFCKGYFSVNIFGINLNISYSSGK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ULI1_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ULI1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ULI1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ULI1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LTE1_YEAST	LTE1	genetic	27708008
GAL10_YEAST	GAL10	genetic	27708008
SGF29_YEAST	SGF29	genetic	27708008
THRC_YEAST	THR4	genetic	27708008
SAC3_YEAST	SAC3	genetic	27708008
MED5_YEAST	NUT1	genetic	27708008
POC2_YEAST	ADD66	genetic	27708008
PRY2_YEAST	PRY2	genetic	27708008
ATG3_YEAST	ATG3	genetic	27708008
MSB4_YEAST	MSB4	genetic	27708008
HDA3_YEAST	HDA3	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ULI1_YEAST

Related Literatures of Post-Translational Modification