UniProt ID | TRA2_DROME | |
---|---|---|
UniProt AC | P19018 | |
Protein Name | Transformer-2 sex-determining protein | |
Gene Name | tra2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 264 | |
Subcellular Localization | ||
Protein Description | Required for female sex determination in somatic cells and for spermatogenesis in male germ cells. Positive regulator of female-specific splicing and/or polyadenylation of doublesex (dsx) pre-mRNA. Splicing requires an enhancer complex, dsxRE (dsx repeat element: which contains six copies of a 13-nucleotide repeat and a purine-rich enhancer (PRE)). DsxRE is formed through cooperative interactions between tra, tra2 and the sr proteins, and these interactions require both the repeat sequences and PRE. PRE is required for specific binding of tra2 to the dsxRE. Protein-RNA and protein-protein interactions are involved in tra-2 dependent activation and repression of alternative splicing. Together with tra-2, plays a role in switching fru splicing from the male-specific pattern to the female-specific pattern through activation of the female-specific fru 5'-splice site.. | |
Protein Sequence | MDREPLSSGRLHCSARYKHKRSASSSSAGTTSSGHKDRRSDYDYCGSRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLRRTSSRY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Phosphorylation | SGHKDRRSDYDYCGS CCCCCCCCCCCCCCH | 41.22 | 19429919 | |
180 | Phosphorylation | SITQRAHTPTPGVYL EEECCCCCCCCCEEE | 28.07 | 19429919 | |
182 | Phosphorylation | TQRAHTPTPGVYLGR ECCCCCCCCCEEECC | 33.55 | 19429919 | |
198 | Phosphorylation | PRGKAPRSFSPRRGR CCCCCCCCCCCCCCC | 29.08 | 25749252 | |
200 | Phosphorylation | GKAPRSFSPRRGRRV CCCCCCCCCCCCCCE | 20.81 | 22668510 | |
212 | Phosphorylation | RRVYHDRSASPYDNY CCEECCCCCCCCCCC | 38.87 | 19429919 | |
214 | Phosphorylation | VYHDRSASPYDNYRD EECCCCCCCCCCCHH | 25.82 | 19429919 | |
219 | Phosphorylation | SASPYDNYRDRYDYR CCCCCCCCHHHCCCC | 15.82 | 25749252 | |
237 | Phosphorylation | YDRNLRRSPSRNRYT CCCCCCCCCCCCHHH | 22.31 | 25749252 | |
239 | Phosphorylation | RNLRRSPSRNRYTRN CCCCCCCCCCHHHCC | 43.35 | 25749252 | |
248 | Phosphorylation | NRYTRNRSYSRSRSP CHHHCCCCCCCCCCH | 30.89 | 22817900 | |
254 | Phosphorylation | RSYSRSRSPQLRRTS CCCCCCCCHHHHHHC | 20.46 | 8124712 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRA2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRA2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRA2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DOA_DROME | Doa | physical | 14605208 | |
RBP1_DROME | Rbp1 | physical | 14605208 | |
SRR55_DROME | B52 | physical | 14605208 | |
Y2199_DROME | CG2199 | physical | 14605208 | |
SRR55_DROME | B52 | genetic | 7565780 | |
TRA2_DROME | tra2 | physical | 8124712 | |
TRSF_DROME | tra | physical | 8124712 | |
DSX_DROME | dsx | physical | 1518835 | |
DSX_DROME | dsx | physical | 1674449 | |
DSX_DROME | dsx | physical | 8124712 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-40; THR-180; SER-212;SER-214 AND SER-254, AND MASS SPECTROMETRY. |