TRA2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRA2_DROME
• UniProt AC: P19018
• Protein Name: Transformer-2 sex-determining protein
• Gene Name: tra2
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 264
• Protein Description: Required for female sex determination in somatic cells and for spermatogenesis in male germ cells. Positive regulator of female-specific splicing and/or polyadenylation of doublesex (dsx) pre-mRNA. Splicing requires an enhancer complex, dsxRE (dsx repeat element: which contains six copies of a 13-nucleotide repeat and a purine-rich enhancer (PRE)). DsxRE is formed through cooperative interactions between tra, tra2 and the sr proteins, and these interactions require both the repeat sequences and PRE. PRE is required for specific binding of tra2 to the dsxRE. Protein-RNA and protein-protein interactions are involved in tra-2 dependent activation and repression of alternative splicing. Together with tra-2, plays a role in switching fru splicing from the male-specific pattern to the female-specific pattern through activation of the female-specific fru 5'-splice site..
• Protein Sequence: MDREPLSSGRLHCSARYKHKRSASSSSAGTTSSGHKDRRSDYDYCGSRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLRRTSSRY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
40	Phosphorylation	SGHKDRRSDYDYCGS CCCCCCCCCCCCCCH	41.22	19429919
180	Phosphorylation	SITQRAHTPTPGVYL EEECCCCCCCCCEEE	28.07	19429919
182	Phosphorylation	TQRAHTPTPGVYLGR ECCCCCCCCCEEECC	33.55	19429919
198	Phosphorylation	PRGKAPRSFSPRRGR CCCCCCCCCCCCCCC	29.08	25749252
200	Phosphorylation	GKAPRSFSPRRGRRV CCCCCCCCCCCCCCE	20.81	22668510
212	Phosphorylation	RRVYHDRSASPYDNY CCEECCCCCCCCCCC	38.87	19429919
214	Phosphorylation	VYHDRSASPYDNYRD EECCCCCCCCCCCHH	25.82	19429919
219	Phosphorylation	SASPYDNYRDRYDYR CCCCCCCCHHHCCCC	15.82	25749252
237	Phosphorylation	YDRNLRRSPSRNRYT CCCCCCCCCCCCHHH	22.31	25749252
239	Phosphorylation	RNLRRSPSRNRYTRN CCCCCCCCCCHHHCC	43.35	25749252
248	Phosphorylation	NRYTRNRSYSRSRSP CHHHCCCCCCCCCCH	30.89	22817900
254	Phosphorylation	RSYSRSRSPQLRRTS CCCCCCCCHHHHHHC	20.46	8124712

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRA2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRA2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRA2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DOA_DROME	Doa	physical	14605208
RBP1_DROME	Rbp1	physical	14605208
SRR55_DROME	B52	physical	14605208
Y2199_DROME	CG2199	physical	14605208
SRR55_DROME	B52	genetic	7565780
TRA2_DROME	tra2	physical	8124712
TRSF_DROME	tra	physical	8124712
DSX_DROME	dsx	physical	1518835
DSX_DROME	dsx	physical	1674449
DSX_DROME	dsx	physical	8124712

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of Drosophila melanogaster embryos.";
Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.;
J. Proteome Res. 7:1675-1682(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-40; THR-180; SER-212;SER-214 AND SER-254, AND MASS SPECTROMETRY.
PubMed: 18327897