UniProt ID | TPM_SCHPO | |
---|---|---|
UniProt AC | Q02088 | |
Protein Name | Tropomyosin | |
Gene Name | cdc8 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 161 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Forms part of the F-actin contractile ring during cytokinesis.. | |
Protein Sequence | MDKLREKINAARAETDEAVARAEAAEAKLKEVELQLSLKEQEYESLSRKSEAAESQLEELEEETKQLRLKADNEDIQKTEAEQLSRKVELLEEELETNDKLLRETTEKMRQTDVKAEHFERRVQSLERERDDMEQKLEEMTDKYTKVKAELDEVHQALEDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
47 | Phosphorylation | EQEYESLSRKSEAAE HHHHHHHHHHHHHHH | 47.11 | 24763107 | |
50 | Phosphorylation | YESLSRKSEAAESQL HHHHHHHHHHHHHHH | 31.21 | 29996109 | |
55 | Phosphorylation | RKSEAAESQLEELEE HHHHHHHHHHHHHHH | 35.03 | 24763107 | |
125 | Phosphorylation | HFERRVQSLERERDD HHHHHHHHHHHHHHH | 29.37 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPM_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPM_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPM_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IMP2_SCHPO | imp2 | genetic | 9786952 | |
RCC1_SCHPO | pim1 | genetic | 12446769 | |
MYO2_SCHPO | myo2 | genetic | 20110347 | |
ACT_SCHPO | act1 | physical | 20705466 | |
FIMB_SCHPO | fim1 | genetic | 20705466 | |
TPM_SCHPO | cdc8 | physical | 21658004 | |
SSP1_SCHPO | ssp1 | genetic | 10233158 | |
TPM_SCHPO | cdc8 | physical | 26771498 | |
MUG79_SCHPO | spo7 | physical | 26771498 | |
YBB9_SCHPO | SPBC13G1.09 | physical | 26771498 | |
ACT_SCHPO | act1 | physical | 27501521 | |
FIMB_SCHPO | fim1 | genetic | 26187949 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...