dbPTM

TNR3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TNR3_SCHPO
UniProt AC	P41888
Protein Name	Thiamine pyrophosphokinase
Gene Name	tnr3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	569
Subcellular Localization	Cytoplasm .
Protein Description	Involved in the regulation of thiamine metabolism, phosphate metabolism, mating and cell growth..
Protein Sequence	MAMSSITSAKQLNAEELLDECDSFNGEFVPGTIPFRANGAAIGYVTPLVLEILIKADNFKFNWVYVPGEYIEINASTFEKRTDILAKVLEHWRHNNTFGIADQWRNELYTVYGKSKKPVLAVERGGFWLFGFLSTGVHCTMYIPATKEHPLRIWVPRRSPTKQTWPNYLDNSVAGGIAHGDSVIGTMIKEFSEEANLDVSSMNLIPCGTVSYIKMEKRHWIQPELQYVFDLPVDDLVIPRINDGEVAGFSLLPLNQVLHELELKSFKPNCALVLLDFLIRHGIITPQHPQYLQTLERIHRPLPVPVGKYERGDSFEDTSKKAETCVPAKPQKATHQLAPCKAWLRDYDTDQKFAVLLLNQPIDIPDDRFRTLWKRASIRVCADGGANQLRNYDSSLKPDYVVGDFDSLTDETKAYYKEMGVNIVFDPCQNTTDFMKCHKIIKEHGIDTIFVLCGMGGRVDHAIGNLNHLFWAASISEKNEVFLLTELNVSTLLQPGINHVDCHDNIGLHCGLLPVGQSVYVKKTSGLEWNIEDRICQFGGLVSSCNVVTKATVTIEVNNFIVWTMETRL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
115	Phosphorylation	LYTVYGKSKKPVLAV EEEEECCCCCCEEEE	41.36	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TNR3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TNR3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TNR3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TNR3_SCHPO	tnr3	physical	26771498
MUG79_SCHPO	spo7	physical	26771498
YB64_SCHPO	SPBC12C2.04	physical	26771498
LAC1_SCHPO	lac1	physical	26771498
SEC31_SCHPO	sec31	physical	26771498
YJM3_SCHPO	mmt1	physical	26771498
MCP2_SCHPO	mcp2	physical	26771498
MU123_SCHPO	mug123	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TNR3_SCHPO

Related Literatures of Post-Translational Modification