dbPTM

LAC1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LAC1_SCHPO
UniProt AC	O59735
Protein Name	Sphingosine N-acyltransferase lac1
Gene Name	lac1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	384
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein.
Protein Description	Component of the ceramide synthase complex required for C26-CoA-dependent ceramide synthesis. Facilitates ER-to-Golgi transport of GPI-anchored proteins (By similarity). Has a role in meiosis..
Protein Sequence	MGNNTSRRSQSQKFKNIPSISAGSFSTMPVQHRGRRRRSKSIVGRAAQNAVLRSKEKTWIVPLILLTLLVGWYFVNPNGYIKYGIFLSYPIPGTNPAQYGKGRLDIAFCLFYALFFTFCREFIMQEIIARIGRHFNIRAPAKLRRFEEQAYTCLYFTVMGSWGLYVMKQTPMWFFNTDAFWEEYPHFYHVGSFKAFYLIEAAYWIQQALVLILQLEKPRKDFKELVVHHIITLLLIGLSYYFHFTWIGLAVFITMDTSDIWLALSKCLNYVNTVIVYPIFVIFVFVWIYMRHYLNFKIMWAVWGTMRTINSFDLDWAAEQYKCWISRDVTLILLTALQLVNIYWLILILRIGYRAFTTNDTHDERSEDEDEEVSDEKSSAKKND

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Phosphorylation	GRRRRSKSIVGRAAQ CCCCCCHHHHHHHHH	24.61	28889911
357	Phosphorylation	RIGYRAFTTNDTHDE HHHHHHHCCCCCCCC	24.57	29996109
359	N-linked_Glycosylation	GYRAFTTNDTHDERS HHHHHCCCCCCCCCC	49.48	-
361	Phosphorylation	RAFTTNDTHDERSED HHHCCCCCCCCCCCC	33.04	28889911
366	Phosphorylation	NDTHDERSEDEDEEV CCCCCCCCCCCCCCC	47.56	28889911
374	Phosphorylation	EDEDEEVSDEKSSAK CCCCCCCCHHHHHHC	43.25	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LAC1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LAC1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LAC1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of LAC1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LAC1_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; THR-361 AND SER-366,AND MASS SPECTROMETRY.	18257517 [Abstract]