UniProt ID | TNNC1_HUMAN | |
---|---|---|
UniProt AC | P63316 | |
Protein Name | Troponin C, slow skeletal and cardiac muscles | |
Gene Name | TNNC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 161 | |
Subcellular Localization | ||
Protein Description | Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.. | |
Protein Sequence | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDDIYKAA -------CHHHHHHH | 10.62 | 3951483 | |
5 | Phosphorylation | ---MDDIYKAAVEQL ---CHHHHHHHHHHH | 11.11 | 24043423 | |
6 | Acetylation | --MDDIYKAAVEQLT --CHHHHHHHHHHHC | 30.15 | 30593029 | |
13 | Phosphorylation | KAAVEQLTEEQKNEF HHHHHHHCHHHHHHH | 36.85 | 24043423 | |
17 | Ubiquitination | EQLTEEQKNEFKAAF HHHCHHHHHHHHHHH | 62.82 | - | |
21 | Acetylation | EEQKNEFKAAFDIFV HHHHHHHHHHHHEEH | 32.40 | 30593023 | |
92 | Ubiquitination | MKDDSKGKSEEELSD HHCCCCCCCHHHHHH | 59.43 | - | |
98 | Phosphorylation | GKSEEELSDLFRMFD CCCHHHHHHHHHHHH | 35.23 | - | |
106 | Ubiquitination | DLFRMFDKNADGYID HHHHHHHCCCCCCCC | 42.65 | - | |
111 | Phosphorylation | FDKNADGYIDLDELK HHCCCCCCCCHHHHH | 7.57 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNNC1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNNC1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNNC1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TNNT1_HUMAN | TNNT1 | physical | 9448267 | |
TNNI3_HUMAN | TNNI3 | physical | 12939162 | |
TNNI3_HUMAN | TNNI3 | physical | 12060657 | |
TNNI3_HUMAN | TNNI3 | physical | 12122471 | |
TNNI1_HUMAN | TNNI1 | physical | 12044157 | |
TNNI2_HUMAN | TNNI2 | physical | 7103951 | |
TRI63_HUMAN | TRIM63 | physical | 15601779 | |
CNN1_HUMAN | CNN1 | physical | 2455687 | |
TNNI3_HUMAN | TNNI3 | physical | 7957210 | |
TNNI1_HUMAN | TNNI1 | physical | 18092822 | |
TNNT2_HUMAN | TNNT2 | physical | 15542288 | |
UBE2C_HUMAN | UBE2C | physical | 21988832 | |
TNNI1_HUMAN | TNNI1 | physical | 21988832 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
611879 | Cardiomyopathy, dilated 1Z (CMD1Z) |
613243 | Cardiomyopathy, familial hypertrophic 13 (CMH13) |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB01244 | Bepridil |
DB01375 | Dihydroxyaluminium |
DB01023 | Felodipine |
DB00922 | Levosimendan |
DB00831 | Trifluoperazine |
loading...