UniProt ID | TLX2_HUMAN | |
---|---|---|
UniProt AC | O43763 | |
Protein Name | T-cell leukemia homeobox protein 2 | |
Gene Name | TLX2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 284 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription activator that binds DNA elements with the consensus sequence 5'-CGGTAATTGG-3'. Binds DNA via its homeobox. Required for normal cell death of enteric neurons in the gastrointestinal tract. Required for normal development of the enteric nervous system, and for proper development of normal motility of the gastrointestinal tract (By similarity).. | |
Protein Sequence | MEPGMLGPHNLPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAFSGGYHGASGYGPAGSLAPLPGSSGVGPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
137 | Phosphorylation | DRLTAALSPFSGTRR HHHHHHCCCCCCCCC | 21.12 | 27732954 | |
140 | Phosphorylation | TAALSPFSGTRRIGH HHHCCCCCCCCCCCC | 42.51 | 27732954 | |
142 | Phosphorylation | ALSPFSGTRRIGHPY HCCCCCCCCCCCCCC | 18.64 | 27732954 | |
149 | Phosphorylation | TRRIGHPYQNRTPPK CCCCCCCCCCCCCCC | 16.85 | 29214152 | |
153 | Phosphorylation | GHPYQNRTPPKRKKP CCCCCCCCCCCCCCC | 52.04 | 28152594 | |
181 | Phosphorylation | RRFLRQKYLASAERA HHHHHHHHHHHHHHH | 10.12 | - | |
184 | Phosphorylation | LRQKYLASAERAALA HHHHHHHHHHHHHHH | 28.24 | - | |
192 | Ubiquitination | AERAALAKALRMTDA HHHHHHHHHHHCCHH | 49.13 | - | |
203 | Phosphorylation | MTDAQVKTWFQNRRT CCHHHHHHHHHHHHH | 32.43 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TLX2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TLX2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TLX2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
1433F_HUMAN | YWHAH | physical | 9738002 | |
IRF6_HUMAN | IRF6 | physical | 20211142 | |
MCM4_HUMAN | MCM4 | physical | 20211142 | |
MEIS1_HUMAN | MEIS1 | physical | 20211142 | |
PO2F1_HUMAN | POU2F1 | physical | 20211142 | |
TLE1_HUMAN | TLE1 | physical | 20211142 | |
IRF9_HUMAN | IRF9 | physical | 20211142 | |
TF2AY_HUMAN | GTF2A1L | physical | 20211142 | |
ZN502_HUMAN | ZNF502 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...