UniProt ID | TKNK_HUMAN | |
---|---|---|
UniProt AC | Q9UHF0 | |
Protein Name | Tachykinin-3 | |
Gene Name | TAC3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 121 | |
Subcellular Localization | Secreted. | |
Protein Description | Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles (By similarity). Is a critical central regulator of gonadal function.. | |
Protein Sequence | MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MRIMLLFTAILAFSL CHHHHHHHHHHHHHH | 16.86 | 29507054 | |
14 | Phosphorylation | FTAILAFSLAQSFGA HHHHHHHHHHHHHCC | 19.72 | 29507054 | |
18 | Phosphorylation | LAFSLAQSFGAVCKE HHHHHHHHHCCCCCC | 21.75 | 29507054 | |
74 | Phosphorylation | ASTDPKESTSPEKRD HCCCCCCCCCHHHHH | 40.07 | - | |
75 | Phosphorylation | STDPKESTSPEKRDM CCCCCCCCCHHHHHH | 49.76 | - | |
90 | Methionine amide | HDFFVGLMGKRSVQP HHHHHHHHCCCCCCC | 4.97 | - | |
90 | Amidation | HDFFVGLMGKRSVQP HHHHHHHHCCCCCCC | 4.97 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TKNK_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TKNK_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TKNK_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CC90B_HUMAN | CCDC90B | physical | 16169070 | |
FEZ1_HUMAN | FEZ1 | physical | 16169070 | |
GASP1_HUMAN | GPRASP1 | physical | 16169070 | |
ELP1_HUMAN | IKBKAP | physical | 16169070 | |
PTN_HUMAN | PTN | physical | 16169070 | |
UBR1_HUMAN | UBR1 | physical | 16169070 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...