| UniProt ID | TKNK_HUMAN | |
|---|---|---|
| UniProt AC | Q9UHF0 | |
| Protein Name | Tachykinin-3 | |
| Gene Name | TAC3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 121 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles (By similarity). Is a critical central regulator of gonadal function.. | |
| Protein Sequence | MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MRIMLLFTAILAFSL CHHHHHHHHHHHHHH | 16.86 | 29507054 | |
| 14 | Phosphorylation | FTAILAFSLAQSFGA HHHHHHHHHHHHHCC | 19.72 | 29507054 | |
| 18 | Phosphorylation | LAFSLAQSFGAVCKE HHHHHHHHHCCCCCC | 21.75 | 29507054 | |
| 74 | Phosphorylation | ASTDPKESTSPEKRD HCCCCCCCCCHHHHH | 40.07 | - | |
| 75 | Phosphorylation | STDPKESTSPEKRDM CCCCCCCCCHHHHHH | 49.76 | - | |
| 90 | Methionine amide | HDFFVGLMGKRSVQP HHHHHHHHCCCCCCC | 4.97 | - | |
| 90 | Amidation | HDFFVGLMGKRSVQP HHHHHHHHCCCCCCC | 4.97 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TKNK_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TKNK_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TKNK_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CC90B_HUMAN | CCDC90B | physical | 16169070 | |
| FEZ1_HUMAN | FEZ1 | physical | 16169070 | |
| GASP1_HUMAN | GPRASP1 | physical | 16169070 | |
| ELP1_HUMAN | IKBKAP | physical | 16169070 | |
| PTN_HUMAN | PTN | physical | 16169070 | |
| UBR1_HUMAN | UBR1 | physical | 16169070 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
