UniProt ID | TIMP2_HUMAN | |
---|---|---|
UniProt AC | P16035 | |
Protein Name | Metalloproteinase inhibitor 2 | |
Gene Name | TIMP2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 220 | |
Subcellular Localization | Secreted. | |
Protein Description | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19.. | |
Protein Sequence | MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
53 | Ubiquitination | RAKAVSEKEVDSGND EEECCCHHHCCCCCC | 56.37 | - | |
57 | Phosphorylation | VSEKEVDSGNDIYGN CCHHHCCCCCCCCCC | 44.67 | - | |
62 | Phosphorylation | VDSGNDIYGNPIKRI CCCCCCCCCCHHHHH | 17.45 | - | |
67 | Ubiquitination | DIYGNPIKRIQYEIK CCCCCHHHHHEEEEE | 44.71 | - | |
74 | Ubiquitination | KRIQYEIKQIKMFKG HHHEEEEEEEECCCC | 33.75 | - | |
90 | Phosphorylation | EKDIEFIYTAPSSAV CCCCEEEEECCCCCE | 11.36 | - | |
165 | Phosphorylation | RCPMIPCYISSPDEC CCCCCCEEECCCCCE | 9.85 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIMP2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIMP2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYUG_HUMAN | SNCG | physical | 17353931 | |
PSA7_HUMAN | PSMA7 | physical | 17353931 | |
MMP2_HUMAN | MMP2 | physical | 10991943 | |
MMP14_HUMAN | MMP14 | physical | 9422789 | |
MMP2_HUMAN | MMP2 | physical | 9182583 | |
TIMP3_HUMAN | TIMP3 | physical | 26186194 | |
HEMH_HUMAN | FECH | physical | 26186194 | |
ZMYM6_HUMAN | ZMYM6 | physical | 26186194 | |
PCSK5_MOUSE | Pcsk5 | physical | 16135528 | |
HEMH_HUMAN | FECH | physical | 28514442 | |
TIMP3_HUMAN | TIMP3 | physical | 28514442 | |
ZMYM6_HUMAN | ZMYM6 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...