| UniProt ID | TIMP3_HUMAN | |
|---|---|---|
| UniProt AC | P35625 | |
| Protein Name | Metalloproteinase inhibitor 3 | |
| Gene Name | TIMP3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 211 | |
| Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
| Protein Description | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.. | |
| Protein Sequence | MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 65 | Ubiquitination | GTLVYTIKQMKMYRG CEEEEEHHHHHHHCC | 36.22 | 32015554 | |
| 99 | Acetylation | GLKLEVNKYQYLLTG CCEEEECEEEEEEEC | 38.62 | 21339330 | |
| 100 | Phosphorylation | LKLEVNKYQYLLTGR CEEEECEEEEEEECE | 9.37 | 22817900 | |
| 102 | Phosphorylation | LEVNKYQYLLTGRVY EEECEEEEEEECEEE | 10.69 | 24043423 | |
| 177 | Phosphorylation | SNFGYPGYQSKHYAC HHCCCCCCCCCCEEE | 12.71 | - | |
| 182 | Phosphorylation | PGYQSKHYACIRQKG CCCCCCCEEEEEECC | 13.60 | - | |
| 195 | Phosphorylation | KGGYCSWYRGWAPPD CCCEECEECCCCCCC | 5.29 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIMP3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIMP3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIMP3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ADA17_HUMAN | ADAM17 | physical | 12044879 | |
| AGTR2_HUMAN | AGTR2 | physical | 18344519 | |
| AGTR2_HUMAN | AGTR2 | genetic | 18344519 | |
| PCSK5_MOUSE | Pcsk5 | physical | 16135528 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 136900 | Sorsby fundus dystrophy (SFD) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
