dbPTM

SWT13_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SWT13_ARATH
UniProt AC	Q9FGQ2
Protein Name	Bidirectional sugar transporter SWEET13 {ECO:0000303\|PubMed:21107422}
Gene Name	SWEET13 {ECO:0000303\|PubMed:21107422}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	294
Subcellular Localization	Cell membrane Multi-pass membrane protein.
Protein Description	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. Involved in nurturing the male gametophyte. [PubMed: 25988582]
Protein Sequence	MALTNNLWAFVFGILGNIISFVVFLAPVPTFVRICKKKSTEGFQSLPYVSALFSAMLWIYYAMQKDGTAFLLITINAFGCVIETIYIVLFVSYANKKTRISTLKVLGLLNFLGFAAIVLVCELLTKGSTREKVLGGICVGFSVSVFAAPLSIMRVVVRTRSVEFMPFSLSLFLTISAVTWLFYGLAIKDFYVALPNVLGAFLGAVQMILYIIFKYYKTPVAQKTDKSKDVSDHSIDIAKLTTVIPGAVLDSAVHQPPALHNVPETKIQLTEVKSQNMTDPKDQINKDVQKQSQV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
142	Phosphorylation	GGICVGFSVSVFAAP HCCCCEEEEEEECCC	13.93	28011693
144	Phosphorylation	ICVGFSVSVFAAPLS CCCEEEEEEECCCCH	15.43	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SWT13_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SWT13_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SWT13_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SWET1_ARATH	AT1G21460	physical	24027245
SWET3_ARATH	AT5G53190	physical	24027245
SWET6_ARATH	AT1G66770	physical	24027245
SWET7_ARATH	AT4G10850	physical	24027245
SWET8_ARATH	AT5G40260	physical	24027245
SWET9_ARATH	AT2G39060	physical	24027245
SWT11_ARATH	AT3G48740	physical	24027245
SWT17_ARATH	AT4G15920	physical	24027245

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SWT13_ARATH

Related Literatures of Post-Translational Modification