UniProt ID | SWET6_ARATH | |
---|---|---|
UniProt AC | Q9C9M9 | |
Protein Name | Bidirectional sugar transporter SWEET6 {ECO:0000303|PubMed:21107422} | |
Gene Name | SWEET6 {ECO:0000303|PubMed:21107422} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 261 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
Protein Description | Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.. | |
Protein Sequence | MVHEQLNLIRKIVGILGNFISLCLFLSPTPTFIHIVKKKSVEKYSPLPYLATLLNCLVRALYGLPMVHPDSTLLVTISGIGITIEIVFLTIFFVFCGRQQHRLVISAVLTVQVVFVATLAVLVLTLEHTTDQRTISVGIVSCVFNAMMYASPLSVMKMVIKTKSLEFMPFLLSVVGFLNAGVWTIYGFVPFDPFLAIPNGIGCVFGLVQLILYGTYYKSTKGIMEERKNRLGYVGEVGLSNAIAQTEPENIPYLNKRVSGV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SWET6_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SWET6_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWET6_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWET6_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SWET5_ARATH | AtVEX1 | physical | 24027245 | |
SWET6_ARATH | AT1G66770 | physical | 24027245 | |
SWET8_ARATH | AT5G40260 | physical | 24027245 | |
SWT17_ARATH | AT4G15920 | physical | 24027245 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...