dbPTM

SWT17_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SWT17_ARATH
UniProt AC	Q84WN3
Protein Name	Bidirectional sugar transporter SWEET17 {ECO:0000303\|PubMed:21107422}
Gene Name	SWEET17 {ECO:0000303\|PubMed:21107422}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	241
Subcellular Localization	Vacuole membrane Multi-pass membrane protein .
Protein Description	Acts as a vacuolar hexose transporter. [PubMed: 25988582 Regulates fructose (Fru) homeostasis in leaves and roots by exporting/importing Fru through the tonoplast regarding metabolic demand]
Protein Sequence	MAEASFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIVTPGEYLVSTVNGFGALVETIYVSLFLFYAPRHLKLKTVDVDAMLNVFFPIAAIVATRSAFEDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYALLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGLSEIAQDEEEGLTSRVEPLLS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SWT17_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SWT17_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SWT17_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SWT17_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SWET1_ARATH	AT1G21460	physical	24027245
SWET7_ARATH	AT4G10850	physical	24027245
SWET8_ARATH	AT5G40260	physical	24027245
SWT16_ARATH	AT3G16690	physical	24027245
SWT17_ARATH	AT4G15920	physical	24027245

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SWT17_ARATH

Related Literatures of Post-Translational Modification