SWET1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SWET1_ARATH
• UniProt AC: Q8L9J7
• Protein Name: Bidirectional sugar transporter SWEET1 {ECO:0000303|PubMed:21107422}
• Gene Name: SWEET1 {ECO:0000303|PubMed:21107422}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 247
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein . Endoplasmic reticulum membrane .
• Protein Description: Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. Can transport glucose, and, to a lower extent, mannose, fructose and galactose..
• Protein Sequence: MNIAHTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSKDNTLVSTINGTGAVIETVYVLIFLFYAPKKEKIKIFGIFSCVLAVFATVALVSLFALQGNGRKLFCGLAATVFSIIMYASPLSIMRLVVKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSADAQKDEKSVEMKDDEKKQNVVNGKQDLQV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SWET1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SWET1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SWET1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SWET1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NIP11_ARATH	NLM1	physical	21798944
SWET1_ARATH	AT1G21460	physical	24027245
SWT17_ARATH	AT4G15920	physical	24027245
CNIH1_ARATH	AT3G12180	physical	24833385
BETL2_ARATH	AT1G29060	physical	24833385
BET12_ARATH	ATBET12	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.