UniProt ID | SWET1_ARATH | |
---|---|---|
UniProt AC | Q8L9J7 | |
Protein Name | Bidirectional sugar transporter SWEET1 {ECO:0000303|PubMed:21107422} | |
Gene Name | SWEET1 {ECO:0000303|PubMed:21107422} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 247 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . Endoplasmic reticulum membrane . |
|
Protein Description | Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. Can transport glucose, and, to a lower extent, mannose, fructose and galactose.. | |
Protein Sequence | MNIAHTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSKDNTLVSTINGTGAVIETVYVLIFLFYAPKKEKIKIFGIFSCVLAVFATVALVSLFALQGNGRKLFCGLAATVFSIIMYASPLSIMRLVVKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSADAQKDEKSVEMKDDEKKQNVVNGKQDLQV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SWET1_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SWET1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWET1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWET1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NIP11_ARATH | NLM1 | physical | 21798944 | |
SWET1_ARATH | AT1G21460 | physical | 24027245 | |
SWT17_ARATH | AT4G15920 | physical | 24027245 | |
CNIH1_ARATH | AT3G12180 | physical | 24833385 | |
BETL2_ARATH | AT1G29060 | physical | 24833385 | |
BET12_ARATH | ATBET12 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...