SWT12_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SWT12_ARATH
• UniProt AC: O82587
• Protein Name: Bidirectional sugar transporter SWEET12 {ECO:0000303|PubMed:21107422}
• Gene Name: SWEET12 {ECO:0000303|PubMed:21107422}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 285
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein. Present in the plasma membrane of the phloem.
• Protein Description: Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. Involved in phloem loading by mediating export from parenchyma cells feeding H(+)-coupled import into the sieve element/companion cell complex, thus contributing to the sucrose migration from sites of synthesis in the mesophyll to the phloem. [PubMed: 22157085]
• Protein Sequence: MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLWLYYATQKKDVFLLVTINSFGCFIETIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILLLCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVIWLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKELEAAKLPEVSIDMVKLGTLTSPEPVAITVVRSVNTCNCNDRNAEIENGQGVRNSAATT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
245	Phosphorylation	IDMVKLGTLTSPEPV EEEEECCCCCCCCCE	36.98	19376835
247	Phosphorylation	MVKLGTLTSPEPVAI EEECCCCCCCCCEEE	41.91	23111157
248	Phosphorylation	VKLGTLTSPEPVAIT EECCCCCCCCCEEEE	30.31	30291188
255	Phosphorylation	SPEPVAITVVRSVNT CCCCEEEEEEEECCC	11.83	19376835

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SWT12_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SWT12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SWT12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SWET5_ARATH	AtVEX1	physical	24027245
SWT12_ARATH	MTN3	physical	24027245
SWT17_ARATH	AT4G15920	physical	24027245
MSBP1_ARATH	MSBP1	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.