| UniProt ID | SRTD1_MOUSE | |
|---|---|---|
| UniProt AC | Q9JL10 | |
| Protein Name | SERTA domain-containing protein 1 | |
| Gene Name | Sertad1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 236 | |
| Subcellular Localization | ||
| Protein Description | Acts at E2F-responsive promoters as coregulator to integrate signals provided by PHD- and/or bromodomain-containing transcription factors. Stimulates E2F1/TFDP1 transcriptional activity. Renders the activity of cyclin D1/CDK4 resistant to the inhibitory effects of CDKN2A/p16INK4A.. | |
| Protein Sequence | MLSKGLKRKREEEETMEALSVDSCWLDPSHPAVAQTPPTVASSSLFDLSVVKLHHSLRQSEPDLRHLVLVVNTLRRIQASMEPAPVLPPEPIQPPAPSVADSLLASSDAGLSASMASLLEDLNHIEDLNQAPQPQADEGPPGRSIGGISPNLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDSELWLPASEGLKPGPENGPAKEEPPELDEAELDYLMDVLVGTQALERPPGPGR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SRTD1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRTD1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRTD1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRTD1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SIR2_MOUSE | Sirt2 | physical | 20211142 | |
| NRIF1_MOUSE | Zfp110 | physical | 20211142 | |
| CERS5_MOUSE | Cers5 | physical | 20211142 | |
| ASB6_MOUSE | Asb6 | physical | 20211142 | |
| CERS2_MOUSE | Cers2 | physical | 20211142 | |
| RBM39_MOUSE | Rbm39 | physical | 20211142 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
