UniProt ID | SPDYA_HUMAN | |
---|---|---|
UniProt AC | Q5MJ70 | |
Protein Name | Speedy protein A | |
Gene Name | SPDYA {ECO:0000312|HGNC:HGNC:30613} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 313 | |
Subcellular Localization | Nucleus . | |
Protein Description | Regulates the G1/S phase transition of the cell cycle by binding and activating CDK1 and CDK2. [PubMed: 12972555 Contributes to CDK2 activation without promoting CDK2 phosphorylation, by inducing a conformation change of the CDK2 T-loop that obstructs the substrate-binding cleft prior to kinase activation] | |
Protein Sequence | MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLKKDKSMEWFTGSEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
222 | Phosphorylation | VQLPRGPSATPVDCS CCCCCCCCCCCCCHH | 47.82 | - | |
224 | Phosphorylation | LPRGPSATPVDCSLC CCCCCCCCCCCHHHC | 28.34 | - | |
247 | Phosphorylation | LGLSSSSSLSSHTAG ECCCCCCCCHHCCCC | 33.93 | - | |
252 | Phosphorylation | SSSLSSHTAGVTEKH CCCCHHCCCCCCCCC | 27.36 | - | |
256 | Phosphorylation | SSHTAGVTEKHSQDS HHCCCCCCCCCCCCC | 38.10 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPDYA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPDYA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDN1B_MOUSE | Cdkn1b | physical | 12972555 | |
CDN1B_HUMAN | CDKN1B | physical | 12972555 | |
CDN1B_HUMAN | CDKN1B | physical | 17671428 | |
CDK2_HUMAN | CDK2 | physical | 17671428 | |
CDK2_HUMAN | CDK2 | physical | 19622356 | |
SKP2_HUMAN | SKP2 | physical | 19622356 | |
CDK2_HUMAN | CDK2 | physical | 11980914 | |
CLIP3_HUMAN | CLIP3 | physical | 26017671 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...