UniProt ID | CLIP3_HUMAN | |
---|---|---|
UniProt AC | Q96DZ5 | |
Protein Name | CAP-Gly domain-containing linker protein 3 | |
Gene Name | CLIP3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 547 | |
Subcellular Localization |
Cell membrane Lipid-anchor . Cytoplasm . Golgi apparatus, Golgi stack . Localized to Golgi stacks as well as on tubulovesicular elements juxtaposed to Golgi cisternae. |
|
Protein Description | Functions as a cytoplasmic linker protein. Involved in TGN-endosome dynamics. May modulate the cellular compartmentalization of AKT kinase family and promote its cell membrane localization, thereby playing a role in glucose transport in adipocytes.. | |
Protein Sequence | MTKTDPAPMAPPPRGEEEEEEEEDEPVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFTFFDPNDPACQEILFDPQTTIPELFAIVRQWVPQVQHKIDVIGNEILRRGCHVNDRDGLTDMTLLHYACKAGAHGVGDPAAAVRLSQQLLALGADVTLRSRWTNMNALHYAAYFDVPDLVRVLLKGARPRVVNSTCSDFNHGSALHIAASSLCLGAAKCLLEHGANPALRNRKGQVPAEVVPDPMDMSLDKAEAALVAKELRTLLEEAVPLSCALPKVTLPNYDNVPGNLMLSALGLRLGDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFASVSKISKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGDQVLVAGQKQGIVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Phosphorylation | EPVPEAPSPTQERRQ CCCCCCCCCCCHHCC | 47.85 | 28176443 | |
34 | Phosphorylation | VPEAPSPTQERRQKP CCCCCCCCCHHCCCC | 47.61 | 28176443 | |
95 | Ubiquitination | WVPQVQHKIDVIGNE HHHHHCHHHEEECHH | 24.42 | 30230243 | |
127 | Ubiquitination | TLLHYACKAGAHGVG HHHHHHHHCCCCCCC | 41.50 | - | |
154 | Phosphorylation | LALGADVTLRSRWTN HHCCCCEEEHHHCCC | 19.59 | 24719451 | |
245 | Phosphorylation | VPDPMDMSLDKAEAA CCCCCCCCCCHHHHH | 29.20 | - | |
256 | Ubiquitination | AEAALVAKELRTLLE HHHHHHHHHHHHHHH | 50.21 | 29967540 | |
260 | Phosphorylation | LVAKELRTLLEEAVP HHHHHHHHHHHHHHC | 48.60 | 22210691 | |
269 | Phosphorylation | LEEAVPLSCALPKVT HHHHHCCCCCCCCEE | 7.41 | 22210691 | |
276 | Phosphorylation | SCALPKVTLPNYDNV CCCCCCEECCCCCCC | 42.49 | 26356563 | |
280 | Phosphorylation | PKVTLPNYDNVPGNL CCEECCCCCCCCCCH | 13.62 | 26356563 | |
290 | Phosphorylation | VPGNLMLSALGLRLG CCCCHHHHHHCCEEC | 13.90 | 22210691 | |
306 | Ubiquitination | RVLLDGQKTGTLRFC EEEECCCCCEEEEEC | 55.22 | 30230243 | |
362 | Ubiquitination | ASVSKISKAVDAPPS EEHHHHHCCCCCCCC | 56.77 | 30230243 | |
369 | Phosphorylation | KAVDAPPSSVTSTPR CCCCCCCCCCCCCCC | 36.06 | 26434776 | |
370 | Phosphorylation | AVDAPPSSVTSTPRT CCCCCCCCCCCCCCC | 34.88 | 26434776 | |
372 | Phosphorylation | DAPPSSVTSTPRTPR CCCCCCCCCCCCCCC | 28.91 | 27732954 | |
373 | Phosphorylation | APPSSVTSTPRTPRM CCCCCCCCCCCCCCC | 33.97 | 24732914 | |
374 | Phosphorylation | PPSSVTSTPRTPRMD CCCCCCCCCCCCCCC | 13.87 | 27732954 | |
377 | Phosphorylation | SVTSTPRTPRMDFSR CCCCCCCCCCCCHHH | 19.22 | 27732954 | |
386 | Phosphorylation | RMDFSRVTGKGRREH CCCHHHCCCCCCCCC | 31.87 | - | |
399 | Phosphorylation | EHKGKKKTPSSPSLG CCCCCCCCCCCCCHH | 36.96 | 23403867 | |
401 | Phosphorylation | KGKKKTPSSPSLGSL CCCCCCCCCCCHHHH | 61.18 | 23403867 | |
402 | Phosphorylation | GKKKTPSSPSLGSLQ CCCCCCCCCCHHHHH | 21.51 | 23403867 | |
404 | Phosphorylation | KKTPSSPSLGSLQQR CCCCCCCCHHHHHHC | 47.51 | 23403867 | |
407 | Phosphorylation | PSSPSLGSLQQRDGA CCCCCHHHHHHCCCC | 28.44 | 20230923 | |
428 | Ubiquitination | QVLVAGQKQGIVRFY EEEECCCCCEEEEEE | 49.96 | 29967540 | |
456 | Ubiquitination | ELDQPTGKHDGSVFG EECCCCCCCCCCEEE | 40.79 | - | |
466 | Phosphorylation | GSVFGVRYFTCPPRH CCEEEEEEEECCCCC | 10.79 | 29759185 | |
480 | Phosphorylation | HGVFAPASRIQRIGG CCCEECHHHEEEECC | 28.93 | 29759185 | |
488 | Phosphorylation | RIQRIGGSTDSPGDS HEEEECCCCCCCCCC | 24.67 | 27732954 | |
489 | Phosphorylation | IQRIGGSTDSPGDSV EEEECCCCCCCCCCC | 43.71 | 27732954 | |
491 | Phosphorylation | RIGGSTDSPGDSVGA EECCCCCCCCCCCCC | 30.76 | 30576142 | |
495 | Phosphorylation | STDSPGDSVGAKKVH CCCCCCCCCCCEEEE | 28.50 | 27732954 | |
499 | Ubiquitination | PGDSVGAKKVHQVTM CCCCCCCEEEEEEEE | 49.77 | 22505724 | |
500 | Ubiquitination | GDSVGAKKVHQVTMT CCCCCCEEEEEEEEC | 44.40 | 29967540 | |
505 | Phosphorylation | AKKVHQVTMTQPKRT CEEEEEEEECCCCCE | 14.13 | 29449344 | |
507 | Phosphorylation | KVHQVTMTQPKRTFT EEEEEEECCCCCEEE | 32.14 | 29449344 | |
510 | Ubiquitination | QVTMTQPKRTFTTVR EEEECCCCCEEEECC | 55.01 | 29967540 | |
512 | Phosphorylation | TMTQPKRTFTTVRTP EECCCCCEEEECCCH | 31.31 | 29449344 | |
514 | Phosphorylation | TQPKRTFTTVRTPKD CCCCCEEEECCCHHH | 24.62 | 29449344 | |
515 | Phosphorylation | QPKRTFTTVRTPKDI CCCCEEEECCCHHHH | 12.09 | 29449344 | |
520 | Ubiquitination | FTTVRTPKDIASENS EEECCCHHHHCCCCH | 62.24 | 32142685 | |
534 | S-palmitoylation | SISRLLFCCWFPWML HHHHHHHHHHHHHHH | 1.70 | 24001771 | |
535 | S-palmitoylation | ISRLLFCCWFPWMLR HHHHHHHHHHHHHHH | 3.08 | 24001771 | |
547 | Phosphorylation | MLRAEMQS------- HHHHHHCC------- | 40.66 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLIP3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLIP3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLIP3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TNR1A_HUMAN | TNFRSF1A | physical | 22297296 | |
TNR21_HUMAN | TNFRSF21 | physical | 22297296 | |
CYLD_HUMAN | CYLD | physical | 22297296 | |
AKT1_HUMAN | AKT1 | physical | 19139280 | |
AKT2_HUMAN | AKT2 | physical | 19139280 | |
SPDYA_HUMAN | SPDYA | physical | 26017671 | |
CYLD_HUMAN | CYLD | physical | 26017671 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...