SOCS2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SOCS2_HUMAN
• UniProt AC: O14508
• Protein Name: Suppressor of cytokine signaling 2
• Gene Name: SOCS2
• Organism: Homo sapiens (Human).
• Sequence Length: 198
• Protein Description: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins..
• Protein Sequence: MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	S-nitrosylation	---MTLRCLEPSGNG ---CCEEEEECCCCC	5.93	24105792
25	Phosphorylation	SQWGTAGSAEEPSPQ CCCCCCCCCCCCCHH	30.00	27732954
30	Phosphorylation	AGSAEEPSPQAARLA CCCCCCCCHHHHHHH	32.68	25159151
38	Ubiquitination	PQAARLAKALRELGQ HHHHHHHHHHHHHHC	53.17	-
52	Phosphorylation	QTGWYWGSMTVNEAK CCCCCCCCCCHHHHH	9.35	31578312
111	S-nitrosylation	FRLDSIICVKSKLKQ EEECEEEEEHHHHCC	2.76	22178444
121	Phosphorylation	SKLKQFDSVVHLIDY HHHCCCCHHHHHHHH	27.59	28270605
128	Phosphorylation	SVVHLIDYYVQMCKD HHHHHHHHHHHHHCC	9.88	28270605
129	Phosphorylation	VVHLIDYYVQMCKDK HHHHHHHHHHHHCCC	4.77	28270605
167	S-nitrosylation	APSLQHLCRLTINKC CHHHHHHHHHHHHCC	2.92	24105792
194	Phosphorylation	LKDYLEEYKFQV--- HHHHHHHHCCCC---	14.02	29759185

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
52	S	Phosphorylation	Kinase	PKC	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
52	S	Phosphorylation	Phosphorylation at Ser-52 by PKC facilitates its ubiquitination and proteosomal degradation.	31578312
52	S	Phosphorylation	Ubiquitination is dependent on its phosphorylation at Ser-52, by PKC.	31578312
52	S	ubiquitylation	Phosphorylation at Ser-52 by PKC facilitates its ubiquitination and proteosomal degradation.	31578312
52	S	ubiquitylation	Ubiquitination is dependent on its phosphorylation at Ser-52, by PKC.	31578312

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SOCS2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IGF1R_HUMAN	IGF1R	physical	9727029
PRLR_HUMAN	PRLR	physical	10455112
SOCS1_HUMAN	SOCS1	physical	17898043
ELOB_HUMAN	TCEB2	physical	21980433
ELOC_HUMAN	TCEB1	physical	21980433
CUL5_HUMAN	CUL5	physical	21980433
RBX2_HUMAN	RNF7	physical	21980433
GHR_HUMAN	GHR	physical	21980433
FAK2_HUMAN	PTK2B	physical	20543098
RYBP_HUMAN	RYBP	physical	20543098
ELOC_HUMAN	TCEB1	physical	19159283
CCNC_HUMAN	CCNC	physical	18508766
FLT3_HUMAN	FLT3	physical	23548639
CUL5_HUMAN	CUL5	physical	23897481
TPD52_HUMAN	TPD52	physical	21988832
ELOB_HUMAN	TCEB2	physical	23333304
ELOC_HUMAN	TCEB1	physical	23333304
GHR_HUMAN	GHR	physical	25505247
STK38_HUMAN	STK38	physical	28216640
CUL5_HUMAN	CUL5	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.